Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3458
Gene name
LocationContig_308:160..457
Strand+
Gene length (bp)297
Transcript length (bp)297
Coding sequence length (bp)297
Protein length (aa) 99

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 14 0.999605

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6426
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7687
Ophiocordyceps australis map64 (Brazil) OphauB2|6362
Ophiocordyceps camponoti-rufipedis Ophun1|3458 (this protein)
Ophiocordyceps kimflemingae Ophio5|2513

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3458
MLLAALLLAPLATALPGPAATSTPPSQAAPTTTTTTTAGPVSLPAVCDYSYCDGRSSWCFYWAGITSYDISRGPV
PGETRVPLGPCGDAVTTTTTARG*
Coding >Ophun1|3458
ATGCTTCTAGCAGCTCTCCTCCTCGCCCCCCTCGCAACCGCCCTCCCCGGCCCAGCCGCAACGAGCACGCCGCCC
TCACAAGCCGCTCCGACGACGACGACGACGACGACGGCCGGACCCGTCAGCTTGCCCGCCGTCTGCGACTATAGC
TACTGCGACGGGCGGTCTTCGTGGTGCTTCTACTGGGCGGGCATCACGTCGTATGATATCTCGAGGGGGCCGGTT
CCGGGCGAGACTAGGGTCCCGCTTGGGCCGTGTGGTGATGCGGTGACGACGACGACGACTGCTAGGGGTTGA
Transcript >Ophun1|3458
ATGCTTCTAGCAGCTCTCCTCCTCGCCCCCCTCGCAACCGCCCTCCCCGGCCCAGCCGCAACGAGCACGCCGCCC
TCACAAGCCGCTCCGACGACGACGACGACGACGACGGCCGGACCCGTCAGCTTGCCCGCCGTCTGCGACTATAGC
TACTGCGACGGGCGGTCTTCGTGGTGCTTCTACTGGGCGGGCATCACGTCGTATGATATCTCGAGGGGGCCGGTT
CCGGGCGAGACTAGGGTCCCGCTTGGGCCGTGTGGTGATGCGGTGACGACGACGACGACTGCTAGGGGTTGA
Gene >Ophun1|3458
ATGCTTCTAGCAGCTCTCCTCCTCGCCCCCCTCGCAACCGCCCTCCCCGGCCCAGCCGCAACGAGCACGCCGCCC
TCACAAGCCGCTCCGACGACGACGACGACGACGACGGCCGGACCCGTCAGCTTGCCCGCCGTCTGCGACTATAGC
TACTGCGACGGGCGGTCTTCGTGGTGCTTCTACTGGGCGGGCATCACGTCGTATGATATCTCGAGGGGGCCGGTT
CCGGGCGAGACTAGGGTCCCGCTTGGGCCGTGTGGTGATGCGGTGACGACGACGACGACTGCTAGGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail