Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3454
Gene name
LocationContig_307:8971..11101
Strand-
Gene length (bp)2130
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 5.9E-18 209 296
PF11915 DUF3433 Protein of unknown function (DUF3433) 6.3E-18 475 558

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 163 185 22
2 205 227 22
3 247 264 17
4 277 299 22
5 324 346 22
6 359 376 17
7 441 463 22
8 468 490 22
9 535 557 22
10 589 611 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3454
MTPIHDEEAYDLSLLQAATPFARNDYNHAAFDVTSALGPLAAPDADFIRKLQAHEASGTLTGGLGRGFSTDRVRV
RGADLLSASSSSASSRRHRLPSLRRPTIGAAGQEEANRSGRIVEVIAEEDIGSLEGGRDARFHSRRSLPPSRVFY
PQPDWRPVSMRLPYLSFLIIISIALAVASEMLYRFHHTGQHPLVRFTSARRLRKIVYLAMRFAPSLCAVSYAVAW
QFLDLDVRRLEAFHQLSRRGGAAAVSSVNVDYMTGYTLLRPLSALRRRHYAVALSSLAANLAASLVPTLAVASLV
LDPSWATRIKDPDVEKKLLIDGTWSRLLTSTLAVCAVAGLLLLWLLQSRQSGLQADAQGIAGLASMAVVSHMLMD
FKDLDTATHRDIHHRLRRKRYVLRNSSLAPLDDDETWSGYYDDQGEDELDTKPPPESPHPLILRPAGWLPFLVGS
AVFMTLIPVMLFTRANVVVDHVPWIITAGAVAVKLSWYAMETAVRVMGPFYILSRRHAPAKTLLLDYTVQPFGWL
PIRALLNGHFLVFAVGLGSVLSELLTILVSGLAMADGMNLTGRSPPSGLAGLRLDAGQETATSFLVNLLLSELIL
AYIFIVGALVFARRSQPFLPRQPNTLASVLAYMHQSKMLYDFVGTETMSGNERERRLAGTGKSYGLGWFRGRDGL
THCGVDEEELTGRYRHGVDGSQQDQPWRTAWDVF*
Coding >Ophun1|3454
ATGACGCCCATCCACGACGAAGAAGCCTACGATCTCTCCCTCCTCCAAGCCGCAACGCCCTTCGCCCGCAACGAC
TACAACCACGCCGCCTTCGACGTCACCTCGGCCCTCGGTCCCCTCGCCGCCCCAGACGCAGACTTCATCCGCAAG
TTACAAGCCCACGAGGCCAGCGGGACCTTGACCGGCGGTCTGGGCCGGGGCTTCTCCACCGACCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCCGCCTCGTCATCGTCGGCGTCTTCCCGGAGGCATCGGCTCCCGTCTCTTCGGAGG
CCTACCATCGGGGCTGCTGGCCAGGAGGAGGCCAATCGAAGCGGACGGATCGTCGAGGTCATTGCTGAAGAGGAT
ATTGGGAGTCTCGAGGGCGGACGCGATGCTCGATTCCACAGTCGTCGTTCTCTGCCGCCATCGCGCGTCTTCTAT
CCACAGCCCGACTGGCGGCCCGTCTCCATGAGGCTTCCCTACCTATCCTTCCTCATCATCATCTCCATTGCTCTG
GCCGTTGCCTCCGAGATGCTGTACCGCTTTCACCACACGGGGCAGCATCCGCTGGTGCGCTTCACGTCAGCTCGC
CGTCTGCGGAAGATTGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTCGATCTTGACGTCCGTCGCCTGGAAGCCTTTCATCAGCTGTCGAGGAGAGGTGGTGCTGCGGCCGTC
TCTTCGGTCAACGTCGATTATATGACGGGGTACACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGACGTCACTAT
GCTGTTGCTTTATCATCGCTGGCTGCTAATCTGGCTGCTTCTCTTGTTCCTACTCTGGCCGTCGCCTCTCTCGTC
CTCGATCCGAGCTGGGCTACCCGCATCAAGGATCCTGATGTCGAGAAGAAGCTGTTGATCGATGGCACCTGGTCA
CGTCTCTTAACATCCACACTGGCCGTCTGTGCCGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGGCAG
TCTGGTCTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGTATGGCTGTCGTCAGCCACATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGCTATGTCCTGCGAAAC
TCGTCTCTGGCGCCTCTCGACGACGACGAGACGTGGAGCGGATACTATGACGACCAAGGCGAAGACGAGCTCGAC
ACGAAGCCGCCGCCAGAGAGTCCACATCCATTGATCCTTCGACCGGCCGGCTGGCTCCCCTTTCTCGTTGGATCA
GCCGTCTTCATGACCCTGATTCCCGTCATGCTCTTTACCAGAGCCAACGTCGTCGTCGATCACGTCCCCTGGATC
ATCACAGCCGGTGCCGTCGCCGTCAAGCTCTCGTGGTACGCCATGGAGACGGCCGTCCGCGTCATGGGGCCCTTT
TACATCCTCTCGCGCCGCCACGCGCCGGCAAAGACTCTGCTGCTCGATTATACCGTCCAACCCTTCGGCTGGCTT
CCCATCCGGGCGCTTCTCAACGGCCACTTTCTCGTCTTTGCCGTCGGACTCGGGAGCGTGCTATCCGAGCTGCTG
ACTATTCTCGTATCAGGCCTGGCCATGGCTGACGGGATGAATCTCACGGGCCGATCCCCGCCTTCCGGGCTCGCG
GGATTGCGTTTGGACGCGGGTCAGGAGACGGCCACGTCCTTCCTGGTGAATCTACTGCTATCAGAGCTGATCCTC
GCCTACATCTTCATCGTCGGAGCCCTCGTCTTCGCCCGCCGCAGCCAGCCATTCCTGCCGAGGCAGCCCAACACG
CTGGCGTCGGTGCTGGCTTACATGCACCAGAGCAAGATGCTGTACGACTTTGTCGGTACCGAGACCATGAGCGGC
AACGAGAGAGAGCGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGACGCGACGGGCTG
ACGCACTGCGGAGTGGACGAGGAGGAGCTGACGGGCAGATATCGGCACGGGGTGGACGGATCGCAGCAGGACCAG
CCGTGGAGGACGGCGTGGGATGTGTTTTGA
Transcript >Ophun1|3454
ATGACGCCCATCCACGACGAAGAAGCCTACGATCTCTCCCTCCTCCAAGCCGCAACGCCCTTCGCCCGCAACGAC
TACAACCACGCCGCCTTCGACGTCACCTCGGCCCTCGGTCCCCTCGCCGCCCCAGACGCAGACTTCATCCGCAAG
TTACAAGCCCACGAGGCCAGCGGGACCTTGACCGGCGGTCTGGGCCGGGGCTTCTCCACCGACCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCCGCCTCGTCATCGTCGGCGTCTTCCCGGAGGCATCGGCTCCCGTCTCTTCGGAGG
CCTACCATCGGGGCTGCTGGCCAGGAGGAGGCCAATCGAAGCGGACGGATCGTCGAGGTCATTGCTGAAGAGGAT
ATTGGGAGTCTCGAGGGCGGACGCGATGCTCGATTCCACAGTCGTCGTTCTCTGCCGCCATCGCGCGTCTTCTAT
CCACAGCCCGACTGGCGGCCCGTCTCCATGAGGCTTCCCTACCTATCCTTCCTCATCATCATCTCCATTGCTCTG
GCCGTTGCCTCCGAGATGCTGTACCGCTTTCACCACACGGGGCAGCATCCGCTGGTGCGCTTCACGTCAGCTCGC
CGTCTGCGGAAGATTGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTCGATCTTGACGTCCGTCGCCTGGAAGCCTTTCATCAGCTGTCGAGGAGAGGTGGTGCTGCGGCCGTC
TCTTCGGTCAACGTCGATTATATGACGGGGTACACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGACGTCACTAT
GCTGTTGCTTTATCATCGCTGGCTGCTAATCTGGCTGCTTCTCTTGTTCCTACTCTGGCCGTCGCCTCTCTCGTC
CTCGATCCGAGCTGGGCTACCCGCATCAAGGATCCTGATGTCGAGAAGAAGCTGTTGATCGATGGCACCTGGTCA
CGTCTCTTAACATCCACACTGGCCGTCTGTGCCGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGGCAG
TCTGGTCTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGTATGGCTGTCGTCAGCCACATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGCTATGTCCTGCGAAAC
TCGTCTCTGGCGCCTCTCGACGACGACGAGACGTGGAGCGGATACTATGACGACCAAGGCGAAGACGAGCTCGAC
ACGAAGCCGCCGCCAGAGAGTCCACATCCATTGATCCTTCGACCGGCCGGCTGGCTCCCCTTTCTCGTTGGATCA
GCCGTCTTCATGACCCTGATTCCCGTCATGCTCTTTACCAGAGCCAACGTCGTCGTCGATCACGTCCCCTGGATC
ATCACAGCCGGTGCCGTCGCCGTCAAGCTCTCGTGGTACGCCATGGAGACGGCCGTCCGCGTCATGGGGCCCTTT
TACATCCTCTCGCGCCGCCACGCGCCGGCAAAGACTCTGCTGCTCGATTATACCGTCCAACCCTTCGGCTGGCTT
CCCATCCGGGCGCTTCTCAACGGCCACTTTCTCGTCTTTGCCGTCGGACTCGGGAGCGTGCTATCCGAGCTGCTG
ACTATTCTCGTATCAGGCCTGGCCATGGCTGACGGGATGAATCTCACGGGCCGATCCCCGCCTTCCGGGCTCGCG
GGATTGCGTTTGGACGCGGGTCAGGAGACGGCCACGTCCTTCCTGGTGAATCTACTGCTATCAGAGCTGATCCTC
GCCTACATCTTCATCGTCGGAGCCCTCGTCTTCGCCCGCCGCAGCCAGCCATTCCTGCCGAGGCAGCCCAACACG
CTGGCGTCGGTGCTGGCTTACATGCACCAGAGCAAGATGCTGTACGACTTTGTCGGTACCGAGACCATGAGCGGC
AACGAGAGAGAGCGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGACGCGACGGGCTG
ACGCACTGCGGAGTGGACGAGGAGGAGCTGACGGGCAGATATCGGCACGGGGTGGACGGATCGCAGCAGGACCAG
CCGTGGAGGACGGCGTGGGATGTGTTTTGA
Gene >Ophun1|3454
ATGACGCCCATCCACGACGAAGAAGCCTACGATCTCTCCCTCCTCCAAGCCGCAACGCCCTTCGCCCGCAACGAC
TACAACCACGCCGCCTTCGACGTCACCTCGGCCCTCGGTCCCCTCGCCGCCCCAGACGCAGACTTCATCCGCAAG
TTACAAGCCCACGAGGCCAGCGGGACCTTGACCGGCGGTCTGGGCCGGGGCTTCTCCACCGACCGGGTGCGCGTT
CGGGGCGCCGACTTGCTCTCCGCCTCGTCATCGTCGGCGTCTTCCCGGAGGCATCGGCTCCCGTCTCTTCGGAGG
CCTACCATCGGGGCTGCTGGCCAGGAGGAGGCCAATCGAAGCGGACGGATCGTCGAGGTCATTGCTGAAGAGGAT
ATTGGGAGTCTCGAGGGCGGACGCGATGCTCGATTCCACAGTCGTCGTTCTCTGCCGCCATCGCGCGTCTTCTAT
CCACAGCCCGACTGGCGGCCCGTCTCCATGAGGCTTCCCTACCTATCCTTCCTCATCATCATCTCCATTGCTCTG
GCCGTTGCCTCCGAGATGCTGTACCGCTTTCACCACACGGGGCAGCATCCGCTGGTGCGCTTCACGTCAGCTCGC
CGTCTGCGGAAGATTGTCTACCTGGCCATGAGATTCGCGCCATCGCTGTGTGCCGTCTCGTACGCTGTTGCCTGG
CAGTTTCTCGATCTTGACGTCCGTCGCCTGGAAGCCTTTCATCAGCTGTCGAGGAGAGGTGGTGCTGCGGCCGTC
TCTTCGGTCAACGTCGATTATATGACGGGGTACACGCTGTTGAGGCCGTTGAGCGCGCTGAGACGACGTCACTAT
GCTGTTGCTTTATCATCGCTGGCTGCTAATCTGGCTGCTTCTCTTGTTCCTACTCTGGCCGTCGCCTCTCTCGTC
CTCGATCCGAGCTGGGCTACCCGCATCAAGGATCCTGATGTCGAGAAGAAGCTGTTGATCGATGGCACCTGGTCA
CGTCTCTTAACATCCACACTGGCCGTCTGTGCCGTCGCCGGCTTGCTTCTGCTCTGGTTGCTGCAGTCGAGGCAG
TCTGGTCTGCAAGCTGATGCTCAGGGCATCGCCGGTCTGGCCAGTATGGCTGTCGTCAGCCACATGCTCATGGAC
TTTAAGGATCTCGACACGGCCACTCATCGGGATATTCATCATCGTCTGAGACGCAAGCGCTATGTCCTGCGAAAC
TCGTCTCTGGCGCCTCTCGACGACGACGAGACGTGGAGCGGATACTATGACGACCAAGGCGAAGACGAGCTCGAC
ACGAAGCCGCCGCCAGAGAGTCCACATCCATTGATCCTTCGACCGGCCGGCTGGCTCCCCTTTCTCGTTGGATCA
GCCGTCTTCATGACCCTGATTCCCGTCATGCTCTTTACCAGAGCCAACGTCGTCGTCGATCACGTCCCCTGGATC
ATCACAGCCGGTGCCGTCGCCGTCAAGCTCTCGTGGTACGCCATGGAGACGGCCGTCCGCGTCATGGGGCCCTTT
TACATCCTCTCGCGCCGCCACGCGCCGGCAAAGACTCTGCTGCTCGATTATACCGTCCAACCCTTCGGCTGGCTT
CCCATCCGGGCGCTTCTCAACGGCCACTTTCTCGTCTTTGCCGTCGGACTCGGGAGCGTGCTATCCGAGCTGCTG
ACTATTCTCGTATCAGGCCTGGCCATGGCTGACGGGATGAATCTCACGGGCCGATCCCCGCCTTCCGGGCTCGCG
GGATTGCGTTTGGACGCGGGTCAGGAGACGGCCACGTCCTTCCTGGTGAATCTACTGCTATCAGAGCTGATCCTC
GCCTACATCTTCATCGTCGGAGCCCTCGTCTTCGCCCGCCGCAGCCAGCCATTCCTGCCGAGGCAGCCCAACACG
CTGGCGTCGGTGCTGGCTTACATGCACCAGAGCAAGATGCTGTACGACTTTGTCGGTACCGAGACCATGAGCGGC
AACGAGAGAGAGCGCAGGCTGGCCGGTACGGGCAAGTCGTACGGGCTCGGCTGGTTCCGGGGACGCGACGGGCTG
ACGCACTGCGGAGTGGACGAGGAGGAGCTGACGGGCAGATATCGGCACGGGGTGGACGGATCGCAGCAGGACCAG
CCGTGGAGGACGGCGTGGGATGTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail