Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3452
Gene name
LocationContig_307:1580..4254
Strand-
Gene length (bp)2674
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07103 DUF1365 Protein of unknown function (DUF1365) 7.9E-56 86 325
PF04828 GFA Glutathione-dependent formaldehyde-activating enzyme 7.6E-24 466 555

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016846 carbon-sulfur lyase activity Yes
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 47 69 22
3 101 123 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3452
MDGFSLSKAVNGLLYALLLLLLSYRLFPSGWLDLIFILISYLWLDAYLPSLTNLLQALLPATLILLVNILRPRRT
SSTGPTKPRLIPCRTTHARLFPQKHAFAYSYLVVGVPVGFSGSAGGIVSAGLEGTSWLERGWFDVDAGDYLFRGA
GGLGLRGKLDDFLRSEHVDPSDYPHAYLLTAARFLGYHFNPVSFWFLYTAEKHLSAMILEVNNTFGERRPYLVFR
NEQHDDIKASWPKDFHVSPFNSRHGSYTVTASDPLGPGMDGFRGLDVSIRLRSSKGRAKLVARLFSEGDAIDASL
MSARQRFGFLVAWCWVGFVTFPRISLVEEKGVSVRYIPSGVVDGPASYTWTANEVVEHVEVRVLTPVFYSRFVGY
VDSLEAVLVEMTVSGTVWIDNPQEYCNAALRLFLSERLLLVDAILLLARAGLAFLTAGVVRGLMPLSGHCLCKAV
TYKADVDAPLMTGYDHCDDCQRQTGSTYSLVALVPKAKLTINGPVKKWSGKGSSGKEVHRLFCSECGSPIAHDPD
AVPEIIVLKAGTLDKEIREKLKPDTEIWTAGKLPFCQEKLAKAFTHMPQ*
Coding >Ophun1|3452
ATGGACGGCTTCTCGCTCAGCAAGGCGGTCAATGGCTTGCTCTACGCTCTTCTCCTCCTCCTACTCTCATACCGG
CTGTTTCCCAGCGGCTGGCTGGACCTCATCTTCATCCTGATATCCTACCTCTGGCTCGACGCCTATCTCCCCTCG
CTCACCAACCTCCTCCAAGCCCTCCTCCCAGCAACCCTCATCCTCCTCGTCAACATCCTCCGCCCACGACGCACG
TCCAGCACCGGCCCGACGAAACCGCGCCTCATCCCCTGCCGCACAACGCACGCCCGCCTCTTCCCGCAGAAGCAC
GCCTTTGCATACTCGTATCTCGTCGTCGGGGTGCCGGTTGGCTTCTCGGGTAGCGCTGGGGGTATCGTCTCGGCG
GGGCTGGAGGGAACGTCGTGGTTGGAGAGGGGTTGGTTTGATGTCGATGCTGGGGATTATCTGTTTAGAGGCGCC
GGTGGGCTTGGTCTGAGGGGGAAGTTGGACGACTTTCTTCGCTCTGAGCATGTTGATCCCAGCGACTATCCGCAC
GCATACCTCCTCACAGCCGCCCGCTTCCTAGGCTACCACTTCAACCCAGTCTCCTTCTGGTTCCTCTACACAGCA
GAAAAGCACCTCTCGGCCATGATCCTCGAAGTAAACAACACCTTTGGCGAAAGACGACCCTACCTCGTCTTCCGA
AACGAGCAGCACGACGACATCAAAGCCTCATGGCCCAAAGACTTTCACGTCTCGCCCTTTAATTCCCGCCATGGA
AGCTACACCGTCACCGCAAGCGATCCCCTCGGTCCCGGGATGGATGGCTTCCGCGGGCTGGACGTCTCTATCCGT
CTGCGCTCGTCCAAGGGGCGGGCTAAGCTTGTTGCTCGTCTGTTTTCCGAGGGGGATGCCATTGACGCGTCGCTG
ATGAGCGCGAGGCAGCGGTTTGGATTCCTCGTTGCTTGGTGTTGGGTGGGGTTCGTGACGTTTCCTCGGATTTCT
CTGGTTGAGGAGAAGGGCGTCTCCGTCAGATATATCCCCAGCGGCGTCGTCGATGGACCTGCTTCTTACACGTGG
ACGGCAAACGAGGTTGTCGAGCACGTCGAGGTGCGGGTTTTGACGCCCGTCTTTTACTCTCGGTTCGTTGGCTAC
GTCGACAGCTTGGAAGCTGTGTTGGTGGAGATGACGGTGAGCGGAACGGTATGGATTGATAACCCGCAAGAATAC
TGCAATGCTGCCCTCCGCCTCTTCCTCTCCGAGCGCCTCCTCCTCGTCGACGCGATCCTGCTGCTTGCGCGCGCG
GGCCTCGCTTTCCTGACGGCCGGGGTGGTACGAGGGTTGATGCCGCTCTCAGGTCACTGCCTCTGCAAGGCCGTC
ACGTACAAGGCCGACGTTGACGCTCCTCTCATGACGGGCTACGACCACTGCGACGACTGCCAGCGTCAAACGGGC
TCGACATACTCCCTCGTCGCCCTCGTCCCCAAGGCAAAGCTCACCATCAACGGCCCCGTCAAGAAATGGTCGGGC
AAGGGCTCTTCGGGCAAGGAGGTGCATCGTCTTTTCTGCTCCGAGTGCGGGTCGCCCATTGCTCATGATCCGGAT
GCCGTGCCGGAAATCATTGTTCTGAAGGCGGGGACGCTGGATAAGGAGATTCGTGAGAAGCTGAAGCCGGATACC
GAGATTTGGACGGCGGGCAAGTTGCCGTTTTGTCAGGAGAAGCTGGCCAAGGCTTTTACACATATGCCGCAGTAA
Transcript >Ophun1|3452
ATGGACGGCTTCTCGCTCAGCAAGGCGGTCAATGGCTTGCTCTACGCTCTTCTCCTCCTCCTACTCTCATACCGG
CTGTTTCCCAGCGGCTGGCTGGACCTCATCTTCATCCTGATATCCTACCTCTGGCTCGACGCCTATCTCCCCTCG
CTCACCAACCTCCTCCAAGCCCTCCTCCCAGCAACCCTCATCCTCCTCGTCAACATCCTCCGCCCACGACGCACG
TCCAGCACCGGCCCGACGAAACCGCGCCTCATCCCCTGCCGCACAACGCACGCCCGCCTCTTCCCGCAGAAGCAC
GCCTTTGCATACTCGTATCTCGTCGTCGGGGTGCCGGTTGGCTTCTCGGGTAGCGCTGGGGGTATCGTCTCGGCG
GGGCTGGAGGGAACGTCGTGGTTGGAGAGGGGTTGGTTTGATGTCGATGCTGGGGATTATCTGTTTAGAGGCGCC
GGTGGGCTTGGTCTGAGGGGGAAGTTGGACGACTTTCTTCGCTCTGAGCATGTTGATCCCAGCGACTATCCGCAC
GCATACCTCCTCACAGCCGCCCGCTTCCTAGGCTACCACTTCAACCCAGTCTCCTTCTGGTTCCTCTACACAGCA
GAAAAGCACCTCTCGGCCATGATCCTCGAAGTAAACAACACCTTTGGCGAAAGACGACCCTACCTCGTCTTCCGA
AACGAGCAGCACGACGACATCAAAGCCTCATGGCCCAAAGACTTTCACGTCTCGCCCTTTAATTCCCGCCATGGA
AGCTACACCGTCACCGCAAGCGATCCCCTCGGTCCCGGGATGGATGGCTTCCGCGGGCTGGACGTCTCTATCCGT
CTGCGCTCGTCCAAGGGGCGGGCTAAGCTTGTTGCTCGTCTGTTTTCCGAGGGGGATGCCATTGACGCGTCGCTG
ATGAGCGCGAGGCAGCGGTTTGGATTCCTCGTTGCTTGGTGTTGGGTGGGGTTCGTGACGTTTCCTCGGATTTCT
CTGGTTGAGGAGAAGGGCGTCTCCGTCAGATATATCCCCAGCGGCGTCGTCGATGGACCTGCTTCTTACACGTGG
ACGGCAAACGAGGTTGTCGAGCACGTCGAGGTGCGGGTTTTGACGCCCGTCTTTTACTCTCGGTTCGTTGGCTAC
GTCGACAGCTTGGAAGCTGTGTTGGTGGAGATGACGGTGAGCGGAACGGTATGGATTGATAACCCGCAAGAATAC
TGCAATGCTGCCCTCCGCCTCTTCCTCTCCGAGCGCCTCCTCCTCGTCGACGCGATCCTGCTGCTTGCGCGCGCG
GGCCTCGCTTTCCTGACGGCCGGGGTGGTACGAGGGTTGATGCCGCTCTCAGGTCACTGCCTCTGCAAGGCCGTC
ACGTACAAGGCCGACGTTGACGCTCCTCTCATGACGGGCTACGACCACTGCGACGACTGCCAGCGTCAAACGGGC
TCGACATACTCCCTCGTCGCCCTCGTCCCCAAGGCAAAGCTCACCATCAACGGCCCCGTCAAGAAATGGTCGGGC
AAGGGCTCTTCGGGCAAGGAGGTGCATCGTCTTTTCTGCTCCGAGTGCGGGTCGCCCATTGCTCATGATCCGGAT
GCCGTGCCGGAAATCATTGTTCTGAAGGCGGGGACGCTGGATAAGGAGATTCGTGAGAAGCTGAAGCCGGATACC
GAGATTTGGACGGCGGGCAAGTTGCCGTTTTGTCAGGAGAAGCTGGCCAAGGCTTTTACACATATGCCGCAGTAA
Gene >Ophun1|3452
ATGGACGGCTTCTCGCTCAGCAAGGCGGTCAATGGCTTGCTCTACGCTCTTCTCCTCCTCCTACTCTCATACCGG
CTGTTTCCCAGCGGCTGGCTGGACCTCATCTTCATCCTGATATCCTACCTCTGGCTCGACGCCTATCTCCCCTCG
CTCACCAACCTCCTCCAAGCCCTCCTCCCAGCAACCCTCATCCTCCTCGTCAACATCCTCCGCCCACGACGCACG
TCCAGCACCGGCCCGACGAAACCGCGCCTCATCCCCTGCCGCACAACGCACGCCCGCCTCTTCCCGCAGAAGCAC
GCCTTTGCATACTCGTATCTCGTCGTCGGGGTGCCGGTTGGCTTCTCGGGTAGCGCTGGGGGTATCGTCTCGGCG
GGGCTGGAGGGAACGTCGTGGTTGGAGAGGGGTTGGTTTGATGTCGATGCTGGGGATTATCTGTTTAGAGGCGCC
GGTGGGCTTGGTCTGAGGGGGAAGTTGGACGACTTTCTTCGCTCTGAGGTTCGTTTACCTTGAGCTTTCTTGGGA
CTTTGCTGATTGTGATGGCAGCATGTTGATCCCAGCGACTATCCGCACGCATACCTCCTCACAGCCGCCCGCTTC
CTAGGCTACCACTTCAACCCAGTCTCCTTCTGGTTCCTCTACACAGCAGAAAAGCACCTCTCGGCCATGATCCTC
GAAGTAAACAACACCTTTGGCGAAAGACGACCCTACCTCGTCTTCCGAAACGAGCAGCACGACGACATCAAAGCC
TCATGGCCCAAAGACTTTCACGTCTCGCCCTTTAATTCCCGCCATGGAAGCTACACCGTCACCGCAAGCGATCCC
CTCGGTCCCGGGATGGATGGCTTCCGCGGGCTGGACGTCTCTATCCGTCTGCGCTCGTCCAAGGGGCGGGCTAAG
CTTGTTGCTCGTCTGTTTTCCGAGGGGGATGCCATTGACGCGTCGCTGATGAGCGCGAGGCAGCGGTTTGGATTC
CTCGTTGCTTGGTGTTGGGTGGGGTTCGTGACGTTTCCTCGGATTGTGAGGGAGGCGGCTGCGCTGTATGTCCGG
CGGGGACTGCATGTTTGGTATCGGCCTGAGCCGTTGAGGGGGAGTTTGGGGAGGGTTGCGGATGGGGGGGAGCGA
TGCCTGGAGCGCGTGTTTCGGGGGTATTTGCAGTCTCTGGTTGAGGAGAAGGGCGTCTCCGTCAGATATATCCCC
AGCGGCGTCGTCGATGGACCTGCTTCTTACACGTGGACGGCAAACGAGGTTGTCGAGCACGTCGAGGTGCGGGTT
TTGACGCCCGTCTTTTACTCTCGGTTCGTTGGCTACGTCGACAGCTTGGAAGCTGTGTTGGTGGAGATGACGGTG
AGCGGAACGGTATGGATTGATAACCCGCAAGGTCTGTCAGTGTTATTCTCTCCCTCGACAGACGAATCTCTACCG
TCGATGAGTTGGAGAGACAGCATCTTGTTCCAACTCATCCGGAACCTCCGCAGACGACCCGCAGCCATTCCCCAA
CCACCACCCCCAAGCTCAACACCCAGTCCTCCCTCAATACCCGCAATGCAAAAGCACCTCTTCTCTCCCCTCGAC
GCCTTCATCATCAGACTCCCAGCCCACTCGGCTTTCAAAGCAGAATACTGCAATGCTGCCCTCCGCCTCTTCCTC
TCCGAGCGCCTCCTCCTCGTCGACGCGATCCTGCTGCTTGCGCGCGCGGGCCTCGCTTTCCTGACGGCCGGGGTG
GTACGAGGGTTGGTGAGCGGGTTTGCCGCGGTATGATGGTGCCCTAAGCGTGCGTTTGTCGGCCGCTATGCCGGT
CTGCGTTAGGGTCGGCTTTGGCGGGTGGTGAGGGTTTGACGGTGATGATGGCGGTTATGGTGGTTGATGATGTTG
GAGAAGACGGGGGTTGATGGTTGGATGGATTGGTCAAGGTGAGTCGTCTTGAGATGATGGAGATGAACAGAAGCA
GCTTCAACCGTCAACTTCAACAAGAAGAAACAAAAGACGAAGAAACCGCGTCATAAGCTTTATCCCGCCCCGCCT
GTCGAACTTGTCCTGATGCGTTCCCGAGACACAGACAGCTCTCGTCACCCTATAAGACATTCAAGCCCGCTCTCT
CCCTCAACCAACCAAGCTCAACTTCACCCTCTCACACTCCTCAACTCAGACTCCAAGATGCCGCTCTCAGGTCAC
TGCCTCTGCAAGGCCGTCACGTACAAGGCCGACGTTGACGCTCCTCTCATGACGGGCTACGACCACTGCGACGAC
TGCCAGCGTCAAACGGGCTCGACATACTGTACTATTATTCCCTGCGGTCTCCTCTCGTCCGGTTGGAAGCTAAAA
CGACGCAGCCCTCGTCGCCCTCGTCCCCAAGGCAAAGCTCACCATCAACGGCCCCGTCAAGAAATGGTCGGGCAA
GGGCTCTTCGGGCAAGGAGGTGCATCGTCTTTTCTGCTCCGAGTGCGGGTCGCCCATTGCTCATGATCCGGATGC
CGTGCCGGAAATCATTGTTCTGAAGGCGGGGACGCTGGATAAGGAGATTCGTGAGAAGCTGAAGCCGGTGAGTTT
TCTTCCGGAATTTGTCGTTGGGGTTGAGGCTGACTTGGAGAAGGATACCGAGATTTGGACGGCGGGCAAGTTGCC
GTTTTGTCAGGAGAAGCTGGCCAAGGCTTTTACACATATGCCGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail