Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3447
Gene name
LocationContig_306:9183..12223
Strand+
Gene length (bp)3040
Transcript length (bp)2943
Coding sequence length (bp)2943
Protein length (aa) 981

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.3E-82 235 797
PF04433 SWIRM SWIRM domain 2.5E-11 125 204
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-08 230 292
PF09011 HMG_box_2 HMG-box domain 2.0E-07 857 928
PF00505 HMG_box HMG (high mobility group) box 1.2E-05 860 930

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 495 816 8.0E-66
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 495 816 9.0E-66
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 495 802 7.0E-64
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 226 800 7.0E-60
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 475 797 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 495 816 8.0E-66
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 495 816 9.0E-66
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 495 802 7.0E-64
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 226 800 7.0E-60
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 475 797 2.0E-56
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 500 799 1.0E-55
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 465 793 4.0E-55
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 484 797 1.0E-54
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 463 799 1.0E-54
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 463 799 1.0E-53
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 465 799 6.0E-53
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 485 811 5.0E-38
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 497 795 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 502 793 8.0E-32
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 495 796 9.0E-32
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 480 796 2.0E-31
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 503 800 4.0E-29
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 476 797 7.0E-29
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 100 358 2.0E-28
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 104 362 1.0E-27
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 538 797 2.0E-27
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 583 823 8.0E-27
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 479 971 3.0E-26
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 538 809 3.0E-26
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 546 797 2.0E-25
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 152 380 2.0E-21
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 560 802 3.0E-21
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 152 362 1.0E-20
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 151 365 9.0E-20
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 582 798 3.0E-19
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 583 798 4.0E-19
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 151 365 4.0E-18
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 514 798 3.0E-17
sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 528 801 6.0E-17
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 122 362 2.0E-16
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 153 387 4.0E-16
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 122 362 4.0E-16
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 151 365 2.0E-15
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 151 365 2.0E-15
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 552 950 2.0E-13
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 153 365 2.0E-13
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 536 796 1.0E-11
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 536 803 4.0E-10
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 536 803 8.0E-10
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 597 803 2.0E-09
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 536 803 2.0E-09
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 153 361 4.0E-09
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 547 799 8.0E-09
sp|Q4F867|OXLA_DABSI L-amino-acid oxidase (Fragments) OS=Daboia siamensis PE=1 SV=2 547 796 2.0E-08
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 539 801 2.0E-08
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 536 803 4.0E-08
sp|G8XQX1|OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii PE=1 SV=1 598 796 5.0E-08
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 547 799 7.0E-08
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 583 800 2.0E-07
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 583 800 2.0E-07
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 536 803 3.0E-07
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 536 803 3.0E-07
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 536 803 4.0E-07
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 536 803 4.0E-07
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 536 796 8.0E-07
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 547 796 2.0E-06
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 151 365 3.0E-06
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 547 818 3.0E-06
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 536 803 3.0E-06
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 592 796 4.0E-06
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 592 796 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4301
Ophiocordyceps australis map64 (Brazil) OphauB2|6346
Ophiocordyceps camponoti-floridani Ophcf2|00442
Ophiocordyceps camponoti-rufipedis Ophun1|3447 (this protein)
Ophiocordyceps kimflemingae Ophio5|4733
Ophiocordyceps subramaniannii Hirsu2|9946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3447
MLAPKPALPASCDKNDAISSFASSLSVLTELSDLSSPPSSEYSKATTPAEADTTRIQPNEDHLKQSEMGDEQRPR
LGDDQGQPSKPSSYYHNIERLSFTIRPKSSIPADMPLEQYASECIDAAESSRLNPYALHPEEYIFLRHHISHAQV
TTYLNIRNGILRLWMLRPWIGVARQDAVACASTRWFDAASVCYDWLVRRGYINFGCVQIPDVSSEKADSPRVKRR
KTVAVIGAGISGLACARQLEGLFKQYAQWHRENGDEVPRVVVLEGRARVGGRVYSREFKSRSVDQQPTRYTAEMG
GMIITGFDRGNPMNVLVRGQLGLPYHPLTADTTIYDSNGKPVDAVRDQLVEKLYNDCLDRVSEFKFKPEPAKLIE
GNRGLLAEGRDSVADGNKTVMQAEEAAAALPHAAPVSQQNVPDKVNLVPVSADKLTGRVHTEPGVPATLRAAEKA
KLMGWNLRSGASGDFNIDLSKAASLPGATLGSVLDEAISQYRNLVDLSAQDHRLINWHVANLEYSNANSLRNLSL
ELWDMDAGNEWEGQHTMVVGGYQAVARGLLQCPTKLDLTTKFPVKSIKYHADGFDGPAIIESESGETIEADCVVC
TVPLGVLKQSSIAFDPPLPPWKKGVIDRLGFGILNKVVLTYDEVFWDPDRHIFGVLRDAPNRHSTAQKDYGANRG
RFFQWFNVSNTTGLPCLIALTGCETEHTSNDQLVAEATDILRSIFGNDVPYPKEAVVTRWGSDRFARGSYSSAAS
GMLPDDYDTMSRPLGNLFFAGEHTIGTHPATVHGAYLSGLRAANEVLEAMIGPLEVPTPLVLPRDSLLLHKRKQA
ADDPRQARLEAYEAEIWDHIRSQIGERPVRPSKAAANAYLIFSKQKLDEARRRCEESRKTGKARNGSSEVRIMLS
KMWKDATPDERRPFELHAAEQKVAHTEAMRVFGEESQKWDREAAALKTAYERDHPSVPGPHEAEEDETPQKHRRV
KLAGG*
Coding >Ophun1|3447
ATGCTGGCTCCGAAGCCCGCTCTGCCTGCTTCTTGCGACAAGAACGATGCCATCAGCTCGTTCGCTTCGTCCCTC
TCGGTCCTAACGGAGCTATCAGATTTATCGTCTCCGCCTTCGAGTGAATATAGCAAGGCCACTACCCCTGCCGAG
GCGGACACGACGCGCATACAGCCAAACGAGGATCACCTAAAGCAGAGTGAGATGGGCGACGAGCAACGGCCCCGG
CTGGGCGACGATCAGGGCCAGCCGAGTAAGCCGTCGTCGTATTACCATAACATCGAACGCCTCAGCTTCACCATC
CGGCCCAAGTCGTCCATCCCCGCCGATATGCCGTTGGAGCAGTACGCCAGCGAGTGCATCGACGCGGCTGAATCG
TCACGGCTCAATCCCTATGCACTCCATCCCGAGGAATACATCTTTCTTCGACACCACATATCACACGCCCAAGTC
ACGACATATCTCAACATCAGAAACGGCATCCTCCGTCTATGGATGCTGCGCCCCTGGATTGGCGTCGCACGGCAA
GACGCCGTCGCCTGTGCCAGTACCCGCTGGTTCGACGCGGCGAGCGTCTGTTACGATTGGCTGGTCCGTCGCGGC
TACATCAACTTTGGCTGCGTACAGATTCCGGACGTCAGCAGCGAGAAAGCAGATTCGCCACGAGTCAAGAGGAGG
AAGACGGTCGCCGTCATCGGCGCCGGCATTTCCGGCCTGGCCTGCGCGAGGCAGCTGGAAGGCCTGTTCAAGCAG
TACGCCCAATGGCATCGCGAGAATGGGGATGAGGTCCCCCGAGTGGTGGTGCTGGAGGGCAGGGCTCGCGTAGGG
GGCAGAGTCTACTCTCGCGAATTCAAGAGCAGGTCTGTCGATCAGCAGCCGACGAGATACACGGCCGAGATGGGC
GGCATGATCATCACGGGCTTCGACCGCGGAAACCCGATGAACGTGCTGGTCCGCGGACAGCTCGGATTGCCCTAC
CACCCGTTGACAGCGGACACGACGATATACGACAGCAACGGCAAGCCGGTAGACGCCGTCCGTGATCAGCTGGTC
GAGAAGCTCTACAACGACTGCCTGGACCGGGTGAGCGAGTTCAAGTTCAAGCCTGAGCCGGCCAAACTGATCGAG
GGCAACCGTGGCCTCCTGGCCGAGGGCCGCGATAGCGTCGCCGACGGCAACAAGACGGTCATGCAGGCCGAGGAA
GCGGCCGCAGCCCTGCCTCATGCAGCTCCCGTGTCGCAGCAGAACGTCCCGGACAAGGTCAACCTCGTACCCGTA
TCGGCCGACAAGCTGACGGGTCGCGTTCATACGGAGCCGGGCGTGCCGGCGACACTGAGGGCCGCCGAAAAGGCC
AAGCTGATGGGCTGGAATTTGCGGTCTGGGGCTTCTGGCGACTTCAACATCGACCTCAGCAAGGCGGCCTCTCTA
CCGGGCGCCACGCTGGGTTCCGTCCTGGACGAGGCCATATCACAGTACAGGAACTTGGTCGATCTGAGCGCGCAA
GACCACCGGCTCATCAACTGGCACGTGGCCAATCTTGAGTACAGCAACGCCAACAGCCTGCGCAACTTGAGCCTC
GAGCTATGGGACATGGACGCCGGAAACGAGTGGGAGGGACAGCACACCATGGTGGTTGGGGGCTACCAGGCCGTC
GCCCGCGGTCTGCTGCAGTGTCCGACCAAGCTGGATCTGACGACCAAGTTTCCCGTTAAGAGTATCAAATATCAT
GCAGACGGTTTCGACGGACCGGCCATCATCGAGTCTGAGAGCGGCGAGACGATCGAAGCTGACTGCGTCGTTTGC
ACCGTCCCGCTCGGCGTTCTGAAGCAGAGCAGCATCGCCTTTGATCCGCCGCTGCCGCCGTGGAAGAAGGGCGTC
ATCGACAGGCTCGGCTTCGGCATACTGAACAAGGTGGTTCTGACCTACGACGAAGTCTTCTGGGACCCCGACAGA
CACATCTTTGGCGTGCTCCGGGACGCACCCAACCGACACAGCACGGCGCAGAAGGACTATGGCGCCAACAGGGGC
CGCTTCTTCCAGTGGTTCAATGTGTCCAACACGACGGGCCTGCCGTGTCTCATCGCGCTGACGGGCTGCGAGACG
GAGCACACGAGCAACGACCAGCTGGTGGCCGAGGCCACTGACATCCTGAGGAGCATCTTTGGAAACGACGTCCCC
TACCCCAAGGAGGCCGTCGTGACGCGCTGGGGGTCGGACCGGTTCGCCAGGGGCAGCTACTCGTCGGCGGCATCG
GGGATGCTCCCGGACGACTACGACACCATGTCCCGCCCTTTGGGGAACCTGTTCTTTGCCGGCGAGCACACCATT
GGCACTCATCCAGCCACGGTCCACGGCGCCTATCTGTCAGGACTCCGTGCGGCTAACGAGGTGCTCGAGGCCATG
ATCGGCCCCCTCGAAGTGCCGACGCCTCTCGTCCTGCCGCGAGATTCGCTCCTGTTGCACAAGCGCAAACAGGCG
GCCGATGATCCCCGCCAGGCCCGACTGGAAGCATACGAGGCCGAGATCTGGGACCACATCCGGTCTCAAATCGGC
GAGCGCCCGGTCCGTCCCAGTAAGGCGGCCGCCAACGCCTACCTTATCTTCAGCAAGCAGAAGCTCGACGAGGCC
AGGCGGCGGTGCGAGGAGAGCCGTAAGACGGGCAAGGCACGCAACGGGTCCAGCGAGGTGCGCATCATGTTATCT
AAGATGTGGAAGGACGCCACGCCCGACGAGCGTCGCCCCTTTGAGCTCCATGCCGCCGAGCAGAAGGTGGCGCAT
ACCGAGGCGATGCGCGTCTTTGGCGAGGAGTCGCAAAAGTGGGATCGCGAGGCTGCCGCCCTCAAAACCGCCTAC
GAGAGGGATCACCCCAGCGTGCCGGGACCGCACGAGGCGGAGGAGGACGAGACGCCACAGAAGCATCGCCGTGTC
AAGCTCGCCGGCGGTTAG
Transcript >Ophun1|3447
ATGCTGGCTCCGAAGCCCGCTCTGCCTGCTTCTTGCGACAAGAACGATGCCATCAGCTCGTTCGCTTCGTCCCTC
TCGGTCCTAACGGAGCTATCAGATTTATCGTCTCCGCCTTCGAGTGAATATAGCAAGGCCACTACCCCTGCCGAG
GCGGACACGACGCGCATACAGCCAAACGAGGATCACCTAAAGCAGAGTGAGATGGGCGACGAGCAACGGCCCCGG
CTGGGCGACGATCAGGGCCAGCCGAGTAAGCCGTCGTCGTATTACCATAACATCGAACGCCTCAGCTTCACCATC
CGGCCCAAGTCGTCCATCCCCGCCGATATGCCGTTGGAGCAGTACGCCAGCGAGTGCATCGACGCGGCTGAATCG
TCACGGCTCAATCCCTATGCACTCCATCCCGAGGAATACATCTTTCTTCGACACCACATATCACACGCCCAAGTC
ACGACATATCTCAACATCAGAAACGGCATCCTCCGTCTATGGATGCTGCGCCCCTGGATTGGCGTCGCACGGCAA
GACGCCGTCGCCTGTGCCAGTACCCGCTGGTTCGACGCGGCGAGCGTCTGTTACGATTGGCTGGTCCGTCGCGGC
TACATCAACTTTGGCTGCGTACAGATTCCGGACGTCAGCAGCGAGAAAGCAGATTCGCCACGAGTCAAGAGGAGG
AAGACGGTCGCCGTCATCGGCGCCGGCATTTCCGGCCTGGCCTGCGCGAGGCAGCTGGAAGGCCTGTTCAAGCAG
TACGCCCAATGGCATCGCGAGAATGGGGATGAGGTCCCCCGAGTGGTGGTGCTGGAGGGCAGGGCTCGCGTAGGG
GGCAGAGTCTACTCTCGCGAATTCAAGAGCAGGTCTGTCGATCAGCAGCCGACGAGATACACGGCCGAGATGGGC
GGCATGATCATCACGGGCTTCGACCGCGGAAACCCGATGAACGTGCTGGTCCGCGGACAGCTCGGATTGCCCTAC
CACCCGTTGACAGCGGACACGACGATATACGACAGCAACGGCAAGCCGGTAGACGCCGTCCGTGATCAGCTGGTC
GAGAAGCTCTACAACGACTGCCTGGACCGGGTGAGCGAGTTCAAGTTCAAGCCTGAGCCGGCCAAACTGATCGAG
GGCAACCGTGGCCTCCTGGCCGAGGGCCGCGATAGCGTCGCCGACGGCAACAAGACGGTCATGCAGGCCGAGGAA
GCGGCCGCAGCCCTGCCTCATGCAGCTCCCGTGTCGCAGCAGAACGTCCCGGACAAGGTCAACCTCGTACCCGTA
TCGGCCGACAAGCTGACGGGTCGCGTTCATACGGAGCCGGGCGTGCCGGCGACACTGAGGGCCGCCGAAAAGGCC
AAGCTGATGGGCTGGAATTTGCGGTCTGGGGCTTCTGGCGACTTCAACATCGACCTCAGCAAGGCGGCCTCTCTA
CCGGGCGCCACGCTGGGTTCCGTCCTGGACGAGGCCATATCACAGTACAGGAACTTGGTCGATCTGAGCGCGCAA
GACCACCGGCTCATCAACTGGCACGTGGCCAATCTTGAGTACAGCAACGCCAACAGCCTGCGCAACTTGAGCCTC
GAGCTATGGGACATGGACGCCGGAAACGAGTGGGAGGGACAGCACACCATGGTGGTTGGGGGCTACCAGGCCGTC
GCCCGCGGTCTGCTGCAGTGTCCGACCAAGCTGGATCTGACGACCAAGTTTCCCGTTAAGAGTATCAAATATCAT
GCAGACGGTTTCGACGGACCGGCCATCATCGAGTCTGAGAGCGGCGAGACGATCGAAGCTGACTGCGTCGTTTGC
ACCGTCCCGCTCGGCGTTCTGAAGCAGAGCAGCATCGCCTTTGATCCGCCGCTGCCGCCGTGGAAGAAGGGCGTC
ATCGACAGGCTCGGCTTCGGCATACTGAACAAGGTGGTTCTGACCTACGACGAAGTCTTCTGGGACCCCGACAGA
CACATCTTTGGCGTGCTCCGGGACGCACCCAACCGACACAGCACGGCGCAGAAGGACTATGGCGCCAACAGGGGC
CGCTTCTTCCAGTGGTTCAATGTGTCCAACACGACGGGCCTGCCGTGTCTCATCGCGCTGACGGGCTGCGAGACG
GAGCACACGAGCAACGACCAGCTGGTGGCCGAGGCCACTGACATCCTGAGGAGCATCTTTGGAAACGACGTCCCC
TACCCCAAGGAGGCCGTCGTGACGCGCTGGGGGTCGGACCGGTTCGCCAGGGGCAGCTACTCGTCGGCGGCATCG
GGGATGCTCCCGGACGACTACGACACCATGTCCCGCCCTTTGGGGAACCTGTTCTTTGCCGGCGAGCACACCATT
GGCACTCATCCAGCCACGGTCCACGGCGCCTATCTGTCAGGACTCCGTGCGGCTAACGAGGTGCTCGAGGCCATG
ATCGGCCCCCTCGAAGTGCCGACGCCTCTCGTCCTGCCGCGAGATTCGCTCCTGTTGCACAAGCGCAAACAGGCG
GCCGATGATCCCCGCCAGGCCCGACTGGAAGCATACGAGGCCGAGATCTGGGACCACATCCGGTCTCAAATCGGC
GAGCGCCCGGTCCGTCCCAGTAAGGCGGCCGCCAACGCCTACCTTATCTTCAGCAAGCAGAAGCTCGACGAGGCC
AGGCGGCGGTGCGAGGAGAGCCGTAAGACGGGCAAGGCACGCAACGGGTCCAGCGAGGTGCGCATCATGTTATCT
AAGATGTGGAAGGACGCCACGCCCGACGAGCGTCGCCCCTTTGAGCTCCATGCCGCCGAGCAGAAGGTGGCGCAT
ACCGAGGCGATGCGCGTCTTTGGCGAGGAGTCGCAAAAGTGGGATCGCGAGGCTGCCGCCCTCAAAACCGCCTAC
GAGAGGGATCACCCCAGCGTGCCGGGACCGCACGAGGCGGAGGAGGACGAGACGCCACAGAAGCATCGCCGTGTC
AAGCTCGCCGGCGGTTAG
Gene >Ophun1|3447
ATGCTGGCTCCGAGTAAGTCCTGACCTGTGAACCTGTGTTTTTTCATCGTTGCATCTCCCTCATCATTAATGTTA
TAAAAGTGGCACTGCGTCTCAACCGCATTGTGAAGAGCCCGCTCTGCCTGCTTCTTGCGACAAGAACGATGCCAT
CAGCTCGTTCGCTTCGTCCCTCTCGGTCCTAACGGAGCTATCAGATTTATCGTCTCCGCCTTCGAGTGAATATAG
CAAGGCCACTACCCCTGCCGAGGCGGACACGACGCGCATACAGCCAAACGAGGATCACCTAAAGCAGAGTGAGAT
GGGCGACGAGCAACGGCCCCGGCTGGGCGACGATCAGGGCCAGCCGAGTAAGCCGTCGTCGTATTACCATAACAT
CGAACGCCTCAGCTTCACCATCCGGCCCAAGTCGTCCATCCCCGCCGATATGCCGTTGGAGCAGTACGCCAGCGA
GTGCATCGACGCGGCTGAATCGTCACGGCTCAATCCCTATGCACTCCATCCCGAGGAATACATCTTTCTTCGACA
CCACATATCACACGCCCAAGTCACGACATATCTCAACATCAGAAACGGCATCCTCCGTCTATGGATGCTGCGCCC
CTGGATTGGCGTCGCACGGCAAGACGCCGTCGCCTGTGCCAGTACCCGCTGGTTCGACGCGGCGAGCGTCTGTTA
CGATTGGCTGGTCCGTCGCGGCTACATCAACTTTGGCTGCGTACAGATTCCGGACGTCAGCAGCGAGAAAGCAGA
TTCGCCACGAGTCAAGAGGAGGAAGACGGTCGCCGTCATCGGCGCCGGCATTTCCGGCCTGGCCTGCGCGAGGCA
GCTGGAAGGCCTGTTCAAGCAGTACGCCCAATGGCATCGCGAGAATGGGGATGAGGTCCCCCGAGTGGTGGTGCT
GGAGGGCAGGGCTCGCGTAGGGGGCAGAGTCTACTCTCGCGAATTCAAGAGCAGGTCTGTCGATCAGCAGCCGAC
GAGATACACGGCCGAGATGGGCGGCATGATCATCACGGGCTTCGACCGCGGAAACCCGATGAACGTGCTGGTCCG
CGGACAGCTCGGATTGCCCTACCACCCGTTGACAGCGGACACGACGATATACGACAGCAACGGCAAGCCGGTAGA
CGCCGTCCGTGATCAGCTGGTCGAGAAGCTCTACAACGACTGCCTGGACCGGGTGAGCGAGTTCAAGTTCAAGCC
TGAGCCGGCCAAACTGATCGAGGGCAACCGTGGCCTCCTGGCCGAGGGCCGCGATAGCGTCGCCGACGGCAACAA
GACGGTCATGCAGGCCGAGGAAGCGGCCGCAGCCCTGCCTCATGCAGCTCCCGTGTCGCAGCAGAACGTCCCGGA
CAAGGTCAACCTCGTACCCGTATCGGCCGACAAGCTGACGGGTCGCGTTCATACGGAGCCGGGCGTGCCGGCGAC
ACTGAGGGCCGCCGAAAAGGCCAAGCTGATGGGCTGGAATTTGCGGTCTGGGGCTTCTGGCGACTTCAACATCGA
CCTCAGCAAGGCGGCCTCTCTACCGGGCGCCACGCTGGGTTCCGTCCTGGACGAGGCCATATCACAGTACAGGAA
CTTGGTCGATCTGAGCGCGCAAGACCACCGGCTCATCAACTGGCACGTGGCCAATCTTGAGTACAGCAACGCCAA
CAGCCTGCGCAACTTGAGCCTCGAGCTATGGGACATGGACGCCGGAAACGAGTGGGAGGGACAGCACACCATGGT
GGTTGGGGGCTACCAGGCCGTCGCCCGCGGTCTGCTGCAGTGTCCGACCAAGCTGGATCTGACGACCAAGTTTCC
CGTTAAGAGTATCAAATATCATGCAGACGGTTTCGACGGACCGGCCATCATCGAGTCTGAGAGCGGCGAGACGAT
CGAAGCTGACTGCGTCGTTTGCACCGTCCCGCTCGGCGTTCTGAAGCAGAGCAGCATCGCCTTTGATCCGCCGCT
GCCGCCGTGGAAGAAGGGCGTCATCGACAGGCTCGGCTTCGGCATACTGAACAAGGTGGTTCTGACCTACGACGA
AGTCTTCTGGGACCCCGACAGACACATCTTTGGCGTGCTCCGGGACGCACCCAACCGACACAGCACGGCGCAGAA
GGACTATGGCGCCAACAGGGGCCGCTTCTTCCAGTGGTTCAATGTGTCCAACACGACGGGCCTGCCGTGTCTCAT
CGCGCTGACGGGCTGCGAGACGGAGCACACGAGCAACGACCAGCTGGTGGCCGAGGCCACTGACATCCTGAGGAG
CATCTTTGGAAACGACGTCCCCTACCCCAAGGAGGCCGTCGTGACGCGCTGGGGGTCGGACCGGTTCGCCAGGGG
CAGCTACTCGTCGGCGGCATCGGGGATGCTCCCGGACGACTACGACACCATGTCCCGCCCTTTGGGGAACCTGTT
CTTTGCCGGCGAGCACACCATTGGCACTCATCCAGCCACGGTCCACGGCGCCTATCTGTCAGGACTCCGTGCGGC
TAACGAGGTGCTCGAGGCCATGATCGGCCCCCTCGAAGTGCCGACGCCTCTCGTCCTGCCGCGAGATTCGCTCCT
GTTGCACAAGCGCAAACAGGCGGCCGATGATCCCCGCCAGGCCCGACTGGAAGCATACGAGGCCGAGATCTGGGA
CCACATCCGGTCTCAAATCGGCGAGCGCCCGGTCCGTCCCAGTAAGGCGGCCGCCAACGCCTACCTTATCTTCAG
CAAGCAGAAGCTCGACGAGGCCAGGCGGCGGTGCGAGGAGAGCCGTAAGACGGGCAAGGCACGCAACGGGTCCAG
CGAGGTGCGCATCATGTTATCTAAGATGTGGAAGGACGCCACGCCCGACGAGCGTCGCCCCTTTGAGCTCCATGC
CGCCGAGCAGAAGGTGGCGCATACCGAGGCGATGCGCGTCTTTGGCGAGGAGTCGCAAAAGTGGGATCGCGAGGC
TGCCGCCCTCAAAACCGCCTACGAGAGGGATCACCCCAGCGTGCCGGGACCGCACGAGGCGGAGGAGGACGAGAC
GCCACAGAAGCATCGCCGTGTCAAGCTCGCCGGCGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail