Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3440
Gene name
LocationContig_305:15562..16834
Strand+
Gene length (bp)1272
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07942 CARME Carnosine N-methyltransferase 4.0E-94 116 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 24 404 2.0E-66
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 35 405 2.0E-64
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 34 405 2.0E-64
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 34 405 5.0E-64
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 35 405 1.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J3|CARME_SCHPO Carnosine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.07 PE=3 SV=1 24 404 2.0E-66
sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens GN=CARNMT1 PE=1 SV=1 35 405 2.0E-64
sp|Q80UY1|CARME_MOUSE Carnosine N-methyltransferase OS=Mus musculus GN=Carnmt1 PE=1 SV=1 34 405 2.0E-64
sp|Q5BJZ6|CARME_RAT Carnosine N-methyltransferase OS=Rattus norvegicus GN=Carnmt1 PE=1 SV=1 34 405 5.0E-64
sp|F1N9S8|CARME_CHICK Carnosine N-methyltransferase OS=Gallus gallus GN=CARNMT1 PE=1 SV=2 35 405 1.0E-62
sp|Q9I7X6|CARME_DROME Carnosine N-methyltransferase OS=Drosophila melanogaster GN=CG11596 PE=1 SV=1 121 405 4.0E-55
sp|P53934|CARME_YEAST Carnosine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL092W PE=1 SV=1 19 384 4.0E-43
sp|Q54ST2|CARME_DICDI Carnosine N-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0282239 PE=3 SV=1 29 403 1.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2644
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5123
Ophiocordyceps australis map64 (Brazil) OphauB2|412
Ophiocordyceps camponoti-floridani Ophcf2|03386
Ophiocordyceps camponoti-rufipedis Ophun1|3440 (this protein)
Ophiocordyceps kimflemingae Ophio5|332
Ophiocordyceps subramaniannii Hirsu2|4058

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3440
MARPDPAVDEETTAWSNVESGTEDPEEVRVIFCALDSFSQYAKVTHFNVTHLRRRSFYALPQAHWKLLAGPPFNF
LDTLVKADEAIDSNAELARAIVGSGLRAFRSLTTAGIMPPEWVGVAKHSDIDKARSTIRQFFRDWAAEGAAEREA
CYGPVLRVLEAERTRAATPHAKVLVPGAGLGRLVFELCRKGFVAEGNEISYHQLLASSYVLNDCVAAGAHTIYPW
IHTFSNHASRQNHLRGYRVPDIHPGSVLAESPNAGGMSMCAADFLCLYGDEAHASCYDAVASVFFLDTAPNLIRY
LEVMHHCLRPGGVLVNVGPLLWHFENQAPTGGQNGGDDDEHGVGGSSGIADPGSFELSDDEVMALLRRLGFTVEW
HETGVEAPYMLDTESMLQTVYRASAWVARKSG*
Coding >Ophun1|3440
ATGGCCCGTCCCGACCCTGCCGTCGACGAGGAGACGACGGCCTGGAGCAACGTCGAGAGCGGCACCGAGGATCCG
GAAGAGGTCAGGGTCATCTTTTGCGCCCTCGACTCCTTTTCCCAGTATGCCAAGGTGACGCACTTCAACGTCACC
CACCTGCGGAGGCGGTCCTTTTACGCCCTGCCCCAGGCCCACTGGAAGCTCCTGGCAGGCCCTCCCTTCAACTTC
CTCGACACGCTGGTCAAGGCCGACGAGGCCATCGACTCCAACGCCGAGCTGGCGCGGGCCATTGTCGGATCCGGC
CTCCGGGCCTTCCGCTCGCTGACCACGGCCGGCATCATGCCTCCGGAGTGGGTCGGCGTGGCCAAGCACTCCGAC
ATCGACAAGGCCAGGAGCACGATCCGCCAGTTCTTCCGCGACTGGGCGGCCGAGGGCGCGGCCGAGAGGGAGGCC
TGCTACGGGCCGGTTCTGAGGGTGCTCGAGGCGGAGCGGACGAGGGCGGCCACGCCGCACGCCAAGGTGCTGGTG
CCCGGCGCCGGTCTCGGCAGGCTGGTTTTTGAGCTCTGTCGCAAGGGCTTCGTGGCCGAGGGCAATGAGATCTCG
TACCACCAGCTGCTGGCATCGTCGTACGTGCTCAACGATTGCGTCGCCGCCGGCGCCCACACCATCTACCCCTGG
ATCCATACATTTTCCAACCACGCGTCGCGGCAGAACCACCTGCGCGGATACAGGGTGCCTGATATTCACCCGGGC
AGCGTCCTGGCCGAAAGCCCCAACGCGGGCGGCATGTCCATGTGCGCGGCCGACTTCTTGTGTCTGTACGGCGAC
GAGGCACACGCATCCTGCTACGACGCCGTCGCCAGCGTCTTCTTCCTCGACACGGCGCCGAACCTGATACGATAC
CTGGAGGTGATGCACCACTGCCTCCGACCCGGCGGCGTGCTCGTCAACGTCGGGCCTCTACTATGGCACTTTGAG
AACCAGGCGCCGACGGGGGGCCAGAACGGCGGCGACGACGACGAGCACGGCGTGGGCGGGTCATCGGGCATCGCC
GACCCCGGAAGCTTTGAGCTTTCGGACGATGAGGTCATGGCTCTGCTGCGGAGGCTGGGCTTCACTGTCGAGTGG
CACGAGACGGGCGTCGAGGCGCCCTACATGCTGGATACGGAGAGTATGCTGCAGACGGTGTACCGGGCGAGCGCG
TGGGTGGCGCGTAAGAGCGGATGA
Transcript >Ophun1|3440
ATGGCCCGTCCCGACCCTGCCGTCGACGAGGAGACGACGGCCTGGAGCAACGTCGAGAGCGGCACCGAGGATCCG
GAAGAGGTCAGGGTCATCTTTTGCGCCCTCGACTCCTTTTCCCAGTATGCCAAGGTGACGCACTTCAACGTCACC
CACCTGCGGAGGCGGTCCTTTTACGCCCTGCCCCAGGCCCACTGGAAGCTCCTGGCAGGCCCTCCCTTCAACTTC
CTCGACACGCTGGTCAAGGCCGACGAGGCCATCGACTCCAACGCCGAGCTGGCGCGGGCCATTGTCGGATCCGGC
CTCCGGGCCTTCCGCTCGCTGACCACGGCCGGCATCATGCCTCCGGAGTGGGTCGGCGTGGCCAAGCACTCCGAC
ATCGACAAGGCCAGGAGCACGATCCGCCAGTTCTTCCGCGACTGGGCGGCCGAGGGCGCGGCCGAGAGGGAGGCC
TGCTACGGGCCGGTTCTGAGGGTGCTCGAGGCGGAGCGGACGAGGGCGGCCACGCCGCACGCCAAGGTGCTGGTG
CCCGGCGCCGGTCTCGGCAGGCTGGTTTTTGAGCTCTGTCGCAAGGGCTTCGTGGCCGAGGGCAATGAGATCTCG
TACCACCAGCTGCTGGCATCGTCGTACGTGCTCAACGATTGCGTCGCCGCCGGCGCCCACACCATCTACCCCTGG
ATCCATACATTTTCCAACCACGCGTCGCGGCAGAACCACCTGCGCGGATACAGGGTGCCTGATATTCACCCGGGC
AGCGTCCTGGCCGAAAGCCCCAACGCGGGCGGCATGTCCATGTGCGCGGCCGACTTCTTGTGTCTGTACGGCGAC
GAGGCACACGCATCCTGCTACGACGCCGTCGCCAGCGTCTTCTTCCTCGACACGGCGCCGAACCTGATACGATAC
CTGGAGGTGATGCACCACTGCCTCCGACCCGGCGGCGTGCTCGTCAACGTCGGGCCTCTACTATGGCACTTTGAG
AACCAGGCGCCGACGGGGGGCCAGAACGGCGGCGACGACGACGAGCACGGCGTGGGCGGGTCATCGGGCATCGCC
GACCCCGGAAGCTTTGAGCTTTCGGACGATGAGGTCATGGCTCTGCTGCGGAGGCTGGGCTTCACTGTCGAGTGG
CACGAGACGGGCGTCGAGGCGCCCTACATGCTGGATACGGAGAGTATGCTGCAGACGGTGTACCGGGCGAGCGCG
TGGGTGGCGCGTAAGAGCGGATGA
Gene >Ophun1|3440
ATGGCCCGTCCCGACCCTGCCGTCGACGAGGAGACGACGGCCTGGAGCAACGTCGAGAGCGGCACCGAGGATCCG
GAAGAGGTCAGGGTCATCTTTTGCGCCCTCGACTCCTTTTCGTGAGCTTCCATTCTCCCCCGGTCTGTCTGTATC
TGACGAGGCGGCAGCCAGTATGCCAAGGTGACGCACTTCAACGTCACCCACCTGCGGAGGCGGTCCTTTTACGCC
CTGCCCCAGGCCCACTGGAAGCTCCTGGCAGGCCCTCCCTTCAACTTCCTCGACACGCTGGTCAAGGCCGACGAG
GCCATCGACTCCAACGCCGAGCTGGCGCGGGCCATTGTCGGATCCGGCCTCCGGGCCTTCCGCTCGCTGACCACG
GCCGGCATCATGCCTCCGGAGTGGGTCGGCGTGGCCAAGCACTCCGACATCGACAAGGCCAGGAGCACGATCCGC
CAGTTCTTCCGCGACTGGGCGGCCGAGGGCGCGGCCGAGAGGGAGGCCTGCTACGGGCCGGTTCTGAGGGTGCTC
GAGGCGGAGCGGACGAGGGCGGCCACGCCGCACGCCAAGGTGCTGGTGCCCGGCGCCGGTCTCGGCAGGCTGGTT
TTTGAGCTCTGTCGCAAGGGCTTCGTGGCCGAGGGCAATGAGATCTCGTACCACCAGCTGCTGGCATCGTCGTAC
GTGCTCAACGATTGCGTCGCCGCCGGCGCCCACACCATCTACCCCTGGATCCATACATTTTCCAACCACGCGTCG
CGGCAGAACCACCTGCGCGGATACAGGGTGCCTGATATTCACCCGGGCAGCGTCCTGGCCGAAAGCCCCAACGCG
GGCGGCATGTCCATGTGCGCGGCCGACTTCTTGTGTCTGTACGGCGACGAGGCACACGCATCCTGCTACGACGCC
GTCGCCAGCGTCTTCTTCCTCGACACGGCGCCGAACCTGATACGATACCTGGAGGTGATGCACCACTGCCTCCGA
CCCGGCGGCGTGCTCGTCAACGTCGGGCCTCTACTATGGCACTTTGAGAACCAGGCGCCGACGGGGGGCCAGAAC
GGCGGCGACGACGACGAGCACGGCGTGGGCGGGTCATCGGGCATCGCCGACCCCGGAAGCTTTGAGCTTTCGGAC
GATGAGGTCATGGCTCTGCTGCGGAGGCTGGGCTTCACTGTCGAGTGGCACGAGACGGGCGTCGAGGCGCCCTAC
ATGCTGGATACGGAGAGTATGCTGCAGACGGTGTACCGGGCGAGCGCGTGGGTGGCGCGTAAGAGCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail