Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3438
Gene name
LocationContig_305:11093..14057
Strand-
Gene length (bp)2964
Transcript length (bp)2844
Coding sequence length (bp)2844
Protein length (aa) 948

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13513 HEAT_EZ HEAT-like repeat 1.3E-17 449 502
PF02985 HEAT HEAT repeat 1.2E-04 436 466
PF02985 HEAT HEAT repeat 3.9E-04 477 505
PF03810 IBN_N Importin-beta N-terminal domain 4.0E-06 32 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 3 923 0.0E+00
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 3 923 0.0E+00
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 3 923 0.0E+00
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 3 916 0.0E+00
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=1 SV=1 1 947 7.0E-179
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 3 923 0.0E+00
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 3 923 0.0E+00
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 3 923 0.0E+00
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 3 916 0.0E+00
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=1 SV=1 1 947 7.0E-179
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 1 947 3.0E-175
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 1 923 3.0E-164
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 3 923 9.0E-150
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 3 923 1.0E-149
sp|P38217|IMB2_YEAST Importin subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP104 PE=1 SV=1 2 877 5.0E-103
sp|Q55CQ7|TNPO_DICDI Transportin OS=Dictyostelium discoideum GN=tnpo PE=3 SV=1 408 947 2.0E-87
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanogaster GN=Fs(2)Ket PE=2 SV=2 12 574 1.0E-16
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 25 549 4.0E-15
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 377 591 3.0E-12
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 383 568 3.0E-10
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 383 568 3.0E-10
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 411 553 5.0E-10
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 411 553 8.0E-10
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 411 553 8.0E-10
sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 387 557 2.0E-09
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 381 557 2.0E-09
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 411 553 3.0E-09
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 408 515 9.0E-09
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 420 560 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0005515 protein binding Yes
GO:0019899 enzyme binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0051020 GTPase binding No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3438
MAWQPAPESLRQLAACLKDSLSGFDKNAQKQAEIMLEQAKASPDVNNYLAYLFSSPQPPDSLQCSEQDYHVVRSA
AGIMLKNNVRSQWKSIPEASLQLIKLAVPLGLQDKNAQMRNFAGNIATEVIKRGGLMAWPDLLPRLLDMISNVGG
QVSVEAQEGAMSAMAKICEDNTRLLIREVNGQRPLNFVLPHLISATKSPHAKVRVGALVAINVFTPRDSQAMLNA
IDDLLQHLFVLSSDQDTDVRRQVCRAFVHLVERRADKLQPHIGGLVDYIISQQQCDDEELACEAAEFWLAVGEHN
DLWRALQPFLGKIIPVLLECMVYGAEDIALLGGLSDDEDEQDRDEDIKPAFAKKNLARAANGEGSAPADLSSKNG
YDKANDMDDGPEEGEISDDDFDGDDGDDDANPDERWTVRKCSAAALDVFARDFRGAVFEAIFPYLSQNLKHEKWS
YREAAVLALGAVAEGCMDVVVPHLPELIPYLISLLEDPEPLVRQITCWTLGRYSSWAANLTDQAQKEQYFVPLMD
GILRKMLDKNKKVQEAGASAFANIEEKAGKRLEPYCGPIIQQFVRCFSRYKDRNMYILYDCVQTLAERIGPLLAT
PELANQLMPALIERYNAVSDESREVFPLLECLSYVALALSHAFAPYAPPIFVRCVNIIHTNLELSLAAAVNAALD
QPNKDFLVTSLDLISAIVQALEGDKSVELIENAPHPFFELLSFCMEDPADDVRQSAYALLGDCAKYLFPRLQPHL
ATMLPILLKQLDIDSVLDEEIDNDFGVVNNACWSAGEIATQHGKGMAPWVPELLQRLVQIMCNPNVPKGLSENAA
IALGRLGLHSADLLAPALSTFSEEFLNAMQEVDPSEEKATAFKGFSVVVGLNPQAMEKVLMDYFVSIAQYQDLNL
RNPIKQELHEVFQNVLNVYKRMIPQFNEFVGQMRPQDQQSLKNNYSI*
Coding >Ophun1|3438
ATGGCCTGGCAACCCGCTCCGGAGTCGCTGAGGCAGCTTGCCGCCTGTCTCAAGGACTCGCTGAGTGGCTTTGAT
AAGAATGCTCAGAAGCAGGCCGAGATCATGCTCGAACAGGCCAAGGCCTCGCCCGATGTCAACAATTATCTCGCC
TACCTCTTCTCCAGTCCTCAGCCTCCCGATAGCCTGCAGTGCAGCGAACAAGACTACCATGTCGTTCGCTCCGCC
GCCGGCATCATGCTCAAGAACAACGTCCGCTCCCAGTGGAAGTCGATACCTGAAGCTAGTTTGCAGCTCATCAAG
CTCGCCGTTCCTCTCGGCCTGCAGGACAAGAACGCCCAGATGCGAAACTTTGCCGGAAACATCGCCACCGAAGTC
ATCAAGAGGGGCGGCCTGATGGCTTGGCCCGACCTGCTTCCGCGTCTCCTCGACATGATTAGCAACGTGGGCGGC
CAGGTCTCCGTCGAGGCTCAAGAGGGCGCCATGTCTGCCATGGCAAAGATCTGTGAGGATAACACACGGCTGCTC
ATCCGAGAGGTTAACGGTCAGCGTCCGCTCAACTTTGTACTGCCTCACCTCATTTCCGCCACCAAGAGCCCGCAC
GCCAAGGTCCGGGTCGGCGCCCTCGTCGCCATCAACGTCTTCACCCCGCGCGATTCGCAGGCCATGCTCAACGCC
ATCGACGATCTGCTCCAGCACCTCTTCGTCCTCTCGAGCGACCAGGACACCGACGTCCGCCGTCAGGTCTGCCGC
GCCTTTGTCCACCTCGTCGAGAGGCGGGCCGACAAGCTGCAGCCTCACATCGGCGGCCTCGTCGACTACATCATC
TCGCAACAGCAGTGCGACGACGAGGAACTGGCCTGCGAGGCGGCCGAGTTCTGGTTGGCCGTCGGCGAGCACAAC
GACCTCTGGCGCGCCCTCCAGCCCTTTCTCGGCAAGATCATCCCCGTCCTCCTCGAGTGCATGGTCTATGGCGCC
GAGGACATCGCCCTCCTCGGCGGCCTGTCGGACGACGAAGACGAGCAGGATCGGGACGAGGACATCAAGCCGGCC
TTTGCCAAGAAGAACCTGGCCCGGGCCGCCAACGGGGAAGGGTCCGCGCCGGCCGACCTGTCGTCCAAGAACGGC
TACGACAAGGCCAACGACATGGACGACGGCCCCGAGGAGGGCGAGATTTCGGATGACGACTTTGACGGCGACGAC
GGCGACGACGACGCCAACCCGGACGAGCGCTGGACCGTCCGCAAGTGCTCGGCCGCCGCCCTCGACGTCTTCGCC
CGCGACTTTCGCGGCGCCGTCTTCGAGGCCATCTTTCCTTACCTGTCGCAGAACCTCAAGCACGAAAAGTGGTCG
TACCGCGAGGCCGCCGTGCTCGCCCTCGGCGCCGTGGCCGAGGGCTGCATGGACGTGGTGGTGCCTCACCTGCCG
GAGCTCATACCTTACCTGATATCTCTGCTCGAGGACCCGGAGCCCCTGGTGCGGCAAATCACCTGCTGGACCCTG
GGTCGTTACTCGTCGTGGGCGGCCAACCTGACGGACCAGGCCCAGAAGGAGCAGTACTTTGTGCCCCTGATGGAC
GGCATCCTGCGCAAGATGCTCGACAAGAACAAAAAGGTGCAGGAAGCGGGCGCCTCGGCCTTTGCCAACATCGAG
GAAAAGGCCGGCAAGCGACTCGAGCCTTACTGCGGCCCCATCATCCAGCAGTTCGTCCGCTGCTTCAGCAGGTAC
AAGGACCGCAACATGTACATCCTCTACGACTGCGTGCAGACGCTGGCCGAGCGCATAGGCCCGCTGCTGGCGACG
CCCGAGCTGGCCAACCAGCTGATGCCGGCGCTGATCGAGCGGTACAACGCCGTGTCGGACGAGTCCCGAGAGGTC
TTCCCCCTGCTCGAGTGCCTGTCGTACGTGGCGCTGGCGCTGAGCCACGCGTTTGCGCCCTACGCGCCCCCCATC
TTCGTCAGGTGCGTCAACATCATCCACACCAACCTGGAGCTGAGCCTGGCGGCGGCCGTCAACGCCGCGCTGGAT
CAGCCCAACAAGGACTTCCTCGTCACCAGCCTGGACCTCATCAGCGCCATCGTCCAGGCGCTCGAGGGCGACAAG
TCGGTGGAGCTGATCGAGAACGCCCCTCACCCCTTCTTCGAGCTGCTGAGCTTCTGCATGGAGGACCCTGCCGAT
GACGTGCGGCAGTCGGCCTACGCGCTGCTGGGCGACTGCGCCAAGTACCTGTTCCCGCGCCTGCAGCCGCACCTG
GCGACGATGCTGCCCATCCTCCTCAAGCAGCTGGACATTGACAGCGTCCTGGACGAGGAGATTGACAACGACTTT
GGCGTCGTTAACAACGCATGCTGGTCGGCCGGCGAGATCGCCACGCAGCACGGCAAGGGAATGGCGCCCTGGGTG
CCCGAGCTCCTGCAGCGGCTGGTCCAGATCATGTGCAACCCCAACGTGCCCAAGGGCCTGAGCGAGAATGCGGCC
ATTGCGCTGGGCCGCCTGGGGCTGCACTCGGCCGACCTGCTGGCGCCCGCGCTGTCGACCTTTTCGGAAGAGTTC
CTCAACGCCATGCAGGAGGTCGACCCGTCGGAGGAGAAGGCGACGGCGTTCAAGGGCTTCTCCGTCGTCGTGGGG
CTCAACCCGCAGGCGATGGAGAAGGTTCTGATGGACTATTTCGTCTCGATTGCGCAGTATCAGGATCTGAATCTG
CGGAATCCCATCAAGCAGGAGCTTCACGAGGTTTTTCAAAACGTGCTCAATGTCTACAAGCGAATGATCCCGCAG
TTTAACGAGTTTGTGGGCCAGATGCGGCCGCAAGATCAACAGAGCCTCAAGAACAACTACTCCATCTGA
Transcript >Ophun1|3438
ATGGCCTGGCAACCCGCTCCGGAGTCGCTGAGGCAGCTTGCCGCCTGTCTCAAGGACTCGCTGAGTGGCTTTGAT
AAGAATGCTCAGAAGCAGGCCGAGATCATGCTCGAACAGGCCAAGGCCTCGCCCGATGTCAACAATTATCTCGCC
TACCTCTTCTCCAGTCCTCAGCCTCCCGATAGCCTGCAGTGCAGCGAACAAGACTACCATGTCGTTCGCTCCGCC
GCCGGCATCATGCTCAAGAACAACGTCCGCTCCCAGTGGAAGTCGATACCTGAAGCTAGTTTGCAGCTCATCAAG
CTCGCCGTTCCTCTCGGCCTGCAGGACAAGAACGCCCAGATGCGAAACTTTGCCGGAAACATCGCCACCGAAGTC
ATCAAGAGGGGCGGCCTGATGGCTTGGCCCGACCTGCTTCCGCGTCTCCTCGACATGATTAGCAACGTGGGCGGC
CAGGTCTCCGTCGAGGCTCAAGAGGGCGCCATGTCTGCCATGGCAAAGATCTGTGAGGATAACACACGGCTGCTC
ATCCGAGAGGTTAACGGTCAGCGTCCGCTCAACTTTGTACTGCCTCACCTCATTTCCGCCACCAAGAGCCCGCAC
GCCAAGGTCCGGGTCGGCGCCCTCGTCGCCATCAACGTCTTCACCCCGCGCGATTCGCAGGCCATGCTCAACGCC
ATCGACGATCTGCTCCAGCACCTCTTCGTCCTCTCGAGCGACCAGGACACCGACGTCCGCCGTCAGGTCTGCCGC
GCCTTTGTCCACCTCGTCGAGAGGCGGGCCGACAAGCTGCAGCCTCACATCGGCGGCCTCGTCGACTACATCATC
TCGCAACAGCAGTGCGACGACGAGGAACTGGCCTGCGAGGCGGCCGAGTTCTGGTTGGCCGTCGGCGAGCACAAC
GACCTCTGGCGCGCCCTCCAGCCCTTTCTCGGCAAGATCATCCCCGTCCTCCTCGAGTGCATGGTCTATGGCGCC
GAGGACATCGCCCTCCTCGGCGGCCTGTCGGACGACGAAGACGAGCAGGATCGGGACGAGGACATCAAGCCGGCC
TTTGCCAAGAAGAACCTGGCCCGGGCCGCCAACGGGGAAGGGTCCGCGCCGGCCGACCTGTCGTCCAAGAACGGC
TACGACAAGGCCAACGACATGGACGACGGCCCCGAGGAGGGCGAGATTTCGGATGACGACTTTGACGGCGACGAC
GGCGACGACGACGCCAACCCGGACGAGCGCTGGACCGTCCGCAAGTGCTCGGCCGCCGCCCTCGACGTCTTCGCC
CGCGACTTTCGCGGCGCCGTCTTCGAGGCCATCTTTCCTTACCTGTCGCAGAACCTCAAGCACGAAAAGTGGTCG
TACCGCGAGGCCGCCGTGCTCGCCCTCGGCGCCGTGGCCGAGGGCTGCATGGACGTGGTGGTGCCTCACCTGCCG
GAGCTCATACCTTACCTGATATCTCTGCTCGAGGACCCGGAGCCCCTGGTGCGGCAAATCACCTGCTGGACCCTG
GGTCGTTACTCGTCGTGGGCGGCCAACCTGACGGACCAGGCCCAGAAGGAGCAGTACTTTGTGCCCCTGATGGAC
GGCATCCTGCGCAAGATGCTCGACAAGAACAAAAAGGTGCAGGAAGCGGGCGCCTCGGCCTTTGCCAACATCGAG
GAAAAGGCCGGCAAGCGACTCGAGCCTTACTGCGGCCCCATCATCCAGCAGTTCGTCCGCTGCTTCAGCAGGTAC
AAGGACCGCAACATGTACATCCTCTACGACTGCGTGCAGACGCTGGCCGAGCGCATAGGCCCGCTGCTGGCGACG
CCCGAGCTGGCCAACCAGCTGATGCCGGCGCTGATCGAGCGGTACAACGCCGTGTCGGACGAGTCCCGAGAGGTC
TTCCCCCTGCTCGAGTGCCTGTCGTACGTGGCGCTGGCGCTGAGCCACGCGTTTGCGCCCTACGCGCCCCCCATC
TTCGTCAGGTGCGTCAACATCATCCACACCAACCTGGAGCTGAGCCTGGCGGCGGCCGTCAACGCCGCGCTGGAT
CAGCCCAACAAGGACTTCCTCGTCACCAGCCTGGACCTCATCAGCGCCATCGTCCAGGCGCTCGAGGGCGACAAG
TCGGTGGAGCTGATCGAGAACGCCCCTCACCCCTTCTTCGAGCTGCTGAGCTTCTGCATGGAGGACCCTGCCGAT
GACGTGCGGCAGTCGGCCTACGCGCTGCTGGGCGACTGCGCCAAGTACCTGTTCCCGCGCCTGCAGCCGCACCTG
GCGACGATGCTGCCCATCCTCCTCAAGCAGCTGGACATTGACAGCGTCCTGGACGAGGAGATTGACAACGACTTT
GGCGTCGTTAACAACGCATGCTGGTCGGCCGGCGAGATCGCCACGCAGCACGGCAAGGGAATGGCGCCCTGGGTG
CCCGAGCTCCTGCAGCGGCTGGTCCAGATCATGTGCAACCCCAACGTGCCCAAGGGCCTGAGCGAGAATGCGGCC
ATTGCGCTGGGCCGCCTGGGGCTGCACTCGGCCGACCTGCTGGCGCCCGCGCTGTCGACCTTTTCGGAAGAGTTC
CTCAACGCCATGCAGGAGGTCGACCCGTCGGAGGAGAAGGCGACGGCGTTCAAGGGCTTCTCCGTCGTCGTGGGG
CTCAACCCGCAGGCGATGGAGAAGGTTCTGATGGACTATTTCGTCTCGATTGCGCAGTATCAGGATCTGAATCTG
CGGAATCCCATCAAGCAGGAGCTTCACGAGGTTTTTCAAAACGTGCTCAATGTCTACAAGCGAATGATCCCGCAG
TTTAACGAGTTTGTGGGCCAGATGCGGCCGCAAGATCAACAGAGCCTCAAGAACAACTACTCCATCTGA
Gene >Ophun1|3438
ATGGCCTGGCAACCCGCTCCGGAGTCGCTGAGGCAGCTTGCCGCCTGTCTCAAGGACTCGCTGAGTGGCTTTGAT
AAGAATGCTCAGAAGCAGGCCGAGATCGTGGGTGATTTCCCTCTCGTTGGCGACCTATCCCTCTCTGCCGTTGAG
CTGACGTCGTCTGCAGATGCTCGAACAGGCCAAGGCCTCGCCCGATGTCAACAATTATCTCGCCTACCTCTTCTC
CAGTCCTCAGCCTCCCGATAGCCTGCAGTGCAGCGAACAAGACTACCATGTCGTTCGCTCCGCCGCCGGCATCAT
GCTCAAGAACAACGTCCGCTCCCAGTGGAAGTCGATACCTGAAGCTAGTTTGCAGCTCATCAAGCTCGCCGTTCC
TCTCGGCCTGCAGGACAAGAACGCCCAGATGCGAAACTTTGCCGGAAACATCGCCACCGAAGTCATCAAGAGGGG
CGGCCTGATGGCTTGGCCCGACCTGCTTCCGCGTCTCCTCGACATGATTAGCAACGTGGGCGGCCAGGTCTCCGT
CGAGGCTCAAGAGGGCGCCATGTCTGCCATGGCAAAGATCTGTGAGGATAACACACGGCTGCTCATCCGAGAGGT
TAACGGTCAGCGTCCGCTCAACTTTGTACTGCCTCACCTCATTTCCGCCACCAAGAGCCCGCACGCCAAGGTCCG
GGTCGGCGCCCTCGTCGCCATCAACGTCTTCACCCCGCGCGATTCGCAGGCCATGCTCAACGCCATCGACGATCT
GCTCCAGCACCTCTTCGTCCTCTCGAGCGACCAGGACACCGACGTCCGCCGTCAGGTCTGCCGCGCCTTTGTCCA
CCTCGTCGAGAGGCGGGCCGACAAGCTGCAGCCTCACATCGGCGGCCTCGTCGACTACATCATCTCGCAACAGCA
GTGCGACGACGAGGAACTGGCCTGCGAGGCGGCCGAGTTCTGGTTGGCCGTCGGCGAGCACAACGACCTCTGGCG
CGCCCTCCAGCCCTTTCTCGGCAAGATCATCCCCGTCCTCCTCGAGTGCATGGTCTATGGCGCCGAGGACATCGC
CCTCCTCGGCGGCCTGTCGGACGACGAAGACGAGCAGGATCGGGACGAGGACATCAAGCCGGCCTTTGCCAAGAA
GAACCTGGCCCGGGCCGCCAACGGGGAAGGGTCCGCGCCGGCCGACCTGTCGTCCAAGAACGGCTACGACAAGGC
CAACGACATGGACGACGGCCCCGAGGAGGGCGAGATTTCGGATGACGACTTTGACGGCGACGACGGCGACGACGA
CGCCAACCCGGACGAGCGCTGGACCGTCCGCAAGTGCTCGGCCGCCGCCCTCGACGTCTTCGCCCGCGACTTTCG
CGGCGCCGTCTTCGAGGCCATCTTTCCTTACCTGTCGCAGAACCTCAAGCACGAAAAGTGGTCGTACCGCGAGGC
CGCCGTGCTCGCCCTCGGCGCCGTGGCCGAGGGCTGCATGGACGTGGTGGTGCCTCACCTGCCGGAGCTCATACC
TTACCTGATATCTCTGCTCGAGGACCCGGAGCCCCTGGTGCGGCAAATCACCTGCTGGACCCTGGGTCGTTACTC
GTCGTGGGCGGCCAACCTGACGGACCAGGCCCAGAAGGAGCAGTACTTTGTGCCCCTGATGGACGGCATCCTGCG
CAAGATGCTCGACAAGAACAAAAAGGTGCAGGAAGCGGGCGCCTCGGCCTTTGCCAACATCGAGGAAAAGGCCGG
CAAGCGACTCGAGCCTTACTGCGGCCCCATCATCCAGCAGTTCGTCCGCTGCTTCAGCAGGTACAAGGACCGCAA
CATGTACATCCTCTACGACTGCGTGCAGACGCTGGCCGAGCGCATAGGCCCGCTGCTGGCGACGCCCGAGCTGGC
CAACCAGCTGATGCCGGCGCTGATCGAGCGGTACAACGCCGTGTCGGACGAGTCCCGAGAGGTCTTCCCCCTGCT
CGAGTGCCTGTCGTACGTGGCGCTGGCGCTGAGCCACGCGTTTGCGCCCTACGCGCCCCCCATCTTCGTCAGGTG
CGTCAACATCATCCACACCAACCTGGAGCTGAGCCTGGCGGCGGCCGTCAACGCCGCGCTGGATCAGCCCAACAA
GGACTTCCTCGTCACCAGCCTGGACCTCATCAGCGCCATCGTCCAGGCGCTCGAGGGCGACAAGTCGGTGGAGCT
GATCGAGAACGCCCCTCACCCCTTCTTCGAGCTGCTGAGCTTCTGCATGGAGGACCCTGCCGATGACGTGCGGCA
GTCGGCCTACGCGCTGCTGGGCGACTGCGCCAAGTACCTGTTCCCGCGCCTGCAGCCGCACCTGGCGACGATGCT
GCCCATCCTCCTCAAGCAGCTGGACATTGACAGCGTCCTGGACGAGGAGATTGACAACGACTTTGGCGTCGTTAA
CAACGCATGCTGGTCGGCCGGCGAGATCGCCACGCAGCACGGCAAGGGAATGGCGCCCTGGGTGCCCGAGCTCCT
GCAGCGGCTGGTCCAGATCATGTGCAACCCCAACGTGCCCAAGGGCCTGAGCGAGAATGCGGCCATTGCGCTGGG
CCGCCTGGGGCTGCACTCGGCCGACCTGCTGGCGCCCGCGCTGTCGACCTTTTCGGAAGAGTTCCTCAACGCCAT
GCAGGAGGTCGACCCGTCGGAGGAGAAGGCGACGGCGTTCAAGGGCTTCTCCGTCGTCGTGGGGCTCAACCCGCA
GGCGATGGAGAAGGTTCTGATGGACTATTTCGTCTCGATTGCGCAGTATCAGGATCTGAATCTGCGGAATCCCAT
CAAGCAGGAGCTTCACGAGGTTTTTCAAAACGTGAGTTGTTCTTGACTCTTGTGCTTGGAGCTCAAGCTGACGTC
GTCTCTTTGCAGGTGCTCAATGTCTACAAGCGAATGATCCCGCAGTTTAACGAGTTTGTGGGCCAGATGCGGCCG
CAAGATCAACAGAGCCTCAAGAACAACTACTCCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail