Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3432
Gene name
LocationContig_304:10819..11957
Strand+
Gene length (bp)1138
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain 3.3E-23 13 126
PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain 1.8E-08 149 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P786|MTD1_SCHPO Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtd1 PE=3 SV=1 9 319 2.0E-118
sp|Q02046|MTD1_YEAST Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTD1 PE=1 SV=1 6 317 7.0E-112
sp|Q86KU6|MTD1_DICDI Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Dictyostelium discoideum GN=thfA PE=3 SV=1 18 318 1.0E-79
sp|A7GXK2|FOLD_CAMC5 Bifunctional protein FolD OS=Campylobacter curvus (strain 525.92) GN=folD PE=3 SV=1 11 327 5.0E-19
sp|A1K589|FOLD_AZOSB Bifunctional protein FolD OS=Azoarcus sp. (strain BH72) GN=folD PE=3 SV=1 9 321 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P786|MTD1_SCHPO Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtd1 PE=3 SV=1 9 319 2.0E-118
sp|Q02046|MTD1_YEAST Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTD1 PE=1 SV=1 6 317 7.0E-112
sp|Q86KU6|MTD1_DICDI Methylenetetrahydrofolate dehydrogenase [NAD(+)] OS=Dictyostelium discoideum GN=thfA PE=3 SV=1 18 318 1.0E-79
sp|A7GXK2|FOLD_CAMC5 Bifunctional protein FolD OS=Campylobacter curvus (strain 525.92) GN=folD PE=3 SV=1 11 327 5.0E-19
sp|A1K589|FOLD_AZOSB Bifunctional protein FolD OS=Azoarcus sp. (strain BH72) GN=folD PE=3 SV=1 9 321 6.0E-18
sp|B9EAY2|FOLD_MACCJ Bifunctional protein FolD OS=Macrococcus caseolyticus (strain JCSC5402) GN=folD PE=3 SV=1 10 210 1.0E-17
sp|B9L952|FOLD_NAUPA Bifunctional protein FolD OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=folD PE=3 SV=1 15 317 1.0E-17
sp|P56467|FOLD_HELPY Bifunctional protein FolD OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=folD PE=3 SV=2 15 210 2.0E-17
sp|B4U8W9|FOLD_HYDS0 Bifunctional protein FolD OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=folD PE=3 SV=1 12 318 2.0E-17
sp|A8ESH8|FOLD_ARCB4 Bifunctional protein FolD OS=Arcobacter butzleri (strain RM4018) GN=folD PE=3 SV=1 12 322 2.0E-17
sp|Q17W13|FOLD_HELAH Bifunctional protein FolD OS=Helicobacter acinonychis (strain Sheeba) GN=folD PE=3 SV=1 8 210 5.0E-17
sp|Q1CTU9|FOLD_HELPH Bifunctional protein FolD OS=Helicobacter pylori (strain HPAG1) GN=folD PE=3 SV=2 12 210 6.0E-17
sp|Q38XU9|FOLD_LACSS Bifunctional protein FolD OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=folD PE=3 SV=1 23 210 6.0E-17
sp|Q55626|FOLD_SYNY3 Bifunctional protein FolD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folD PE=3 SV=1 5 210 7.0E-17
sp|Q4L572|FOLD_STAHJ Bifunctional protein FolD OS=Staphylococcus haemolyticus (strain JCSC1435) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q2YX11|FOLD_STAAB Bifunctional protein FolD OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q9ZLQ4|FOLD_HELPJ Bifunctional protein FolD OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=folD PE=3 SV=1 12 210 1.0E-16
sp|B2VBD1|FOLD_ERWT9 Bifunctional protein FolD OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=folD PE=3 SV=1 11 317 1.0E-16
sp|Q6GI21|FOLD_STAAR Bifunctional protein FolD OS=Staphylococcus aureus (strain MRSA252) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q8A7B8|FOLD_BACTN Bifunctional protein FolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=folD PE=3 SV=1 12 320 1.0E-16
sp|Q8NX95|FOLD_STAAW Bifunctional protein FolD OS=Staphylococcus aureus (strain MW2) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|A8Z1K5|FOLD_STAAT Bifunctional protein FolD OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q6GAF0|FOLD_STAAS Bifunctional protein FolD OS=Staphylococcus aureus (strain MSSA476) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|A6QFS2|FOLD_STAAE Bifunctional protein FolD OS=Staphylococcus aureus (strain Newman) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q5HH21|FOLD_STAAC Bifunctional protein FolD OS=Staphylococcus aureus (strain COL) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q2FZJ6|FOLD_STAA8 Bifunctional protein FolD OS=Staphylococcus aureus (strain NCTC 8325) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q2FI15|FOLD_STAA3 Bifunctional protein FolD OS=Staphylococcus aureus (strain USA300) GN=folD PE=3 SV=1 10 310 1.0E-16
sp|Q7A697|FOLD_STAAN Bifunctional protein FolD OS=Staphylococcus aureus (strain N315) GN=folD PE=1 SV=1 10 310 2.0E-16
sp|Q99V34|FOLD_STAAM Bifunctional protein FolD OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=folD PE=3 SV=1 10 310 2.0E-16
sp|A5IRV0|FOLD_STAA9 Bifunctional protein FolD OS=Staphylococcus aureus (strain JH9) GN=folD PE=3 SV=1 10 310 2.0E-16
sp|A6U0N1|FOLD_STAA2 Bifunctional protein FolD OS=Staphylococcus aureus (strain JH1) GN=folD PE=3 SV=1 10 310 2.0E-16
sp|A7X0V3|FOLD_STAA1 Bifunctional protein FolD OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=folD PE=3 SV=1 10 310 2.0E-16
sp|A5FNE3|FOLD_FLAJ1 Bifunctional protein FolD OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=folD PE=3 SV=1 14 321 2.0E-16
sp|A4XLE0|FOLD_CALS8 Bifunctional protein FolD OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=folD PE=3 SV=1 18 310 4.0E-16
sp|Q64RB7|FOLD_BACFR Bifunctional protein FolD OS=Bacteroides fragilis (strain YCH46) GN=folD PE=3 SV=1 12 320 4.0E-16
sp|Q5LAX0|FOLD_BACFN Bifunctional protein FolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=folD PE=3 SV=1 12 320 4.0E-16
sp|Q92BZ4|FOLD_LISIN Bifunctional protein FolD OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=folD PE=3 SV=1 11 313 5.0E-16
sp|A5CVZ6|FOLD_VESOH Bifunctional protein FolD OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=folD PE=3 SV=1 12 310 6.0E-16
sp|A0M554|FOLD_GRAFK Bifunctional protein FolD OS=Gramella forsetii (strain KT0803) GN=folD PE=3 SV=1 12 325 6.0E-16
sp|Q1GXE6|FOLD_METFK Bifunctional protein FolD OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=folD PE=3 SV=1 9 310 8.0E-16
sp|Q5HQA7|FOLD_STAEQ Bifunctional protein FolD OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folD PE=3 SV=1 38 310 9.0E-16
sp|Q12V26|FOLD_METBU Bifunctional protein FolD OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=folD PE=3 SV=1 11 312 1.0E-15
sp|B9DQ45|FOLD_STACT Bifunctional protein FolD OS=Staphylococcus carnosus (strain TM300) GN=folD PE=3 SV=1 10 310 1.0E-15
sp|Q8CPP4|FOLD_STAES Bifunctional protein FolD OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folD PE=3 SV=1 38 310 1.0E-15
sp|A9A4N5|FOLD_NITMS Bifunctional protein FolD OS=Nitrosopumilus maritimus (strain SCM1) GN=folD PE=3 SV=1 13 312 2.0E-15
sp|A6L8J2|FOLD_PARD8 Bifunctional protein FolD OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=folD PE=3 SV=1 11 320 2.0E-15
sp|B1LAQ6|FOLD_THESQ Bifunctional protein FolD OS=Thermotoga sp. (strain RQ2) GN=folD PE=3 SV=1 13 313 2.0E-15
sp|A0KJD4|FOLD_AERHH Bifunctional protein FolD OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=folD PE=3 SV=1 15 310 2.0E-15
sp|Q30RJ0|FOLD_SULDN Bifunctional protein FolD OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=folD PE=3 SV=1 19 210 2.0E-15
sp|Q5HUU1|FOLD_CAMJR Bifunctional protein FolD OS=Campylobacter jejuni (strain RM1221) GN=folD PE=3 SV=1 19 318 2.0E-15
sp|A5WGG4|FOLD_PSYWF Bifunctional protein FolD OS=Psychrobacter sp. (strain PRwf-1) GN=folD PE=3 SV=1 9 312 2.0E-15
sp|Q3K9W7|FOLD_PSEPF Bifunctional protein FolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=folD PE=3 SV=1 9 310 3.0E-15
sp|Q5QWH6|FOLD_IDILO Bifunctional protein FolD OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=folD PE=3 SV=1 11 313 4.0E-15
sp|A6L2G2|FOLD_BACV8 Bifunctional protein FolD OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=folD PE=3 SV=1 11 320 4.0E-15
sp|Q9X288|FOLD_THEMA Bifunctional protein FolD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=folD PE=3 SV=1 13 313 4.0E-15
sp|B7LJI7|FOLD_ESCF3 Bifunctional protein FolD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=folD PE=3 SV=1 11 313 4.0E-15
sp|Q160C1|FOLD2_ROSDO Bifunctional protein FolD 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=folD2 PE=3 SV=1 12 312 4.0E-15
sp|A7I254|FOLD_CAMHC Bifunctional protein FolD OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=folD PE=3 SV=1 11 318 4.0E-15
sp|Q83FS2|FOLD_TROWT Bifunctional protein FolD OS=Tropheryma whipplei (strain Twist) GN=folD PE=3 SV=1 11 314 5.0E-15
sp|C0M7V0|FOLD_STRE4 Bifunctional protein FolD OS=Streptococcus equi subsp. equi (strain 4047) GN=folD PE=3 SV=1 11 308 5.0E-15
sp|A6GZM5|FOLD_FLAPJ Bifunctional protein FolD OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=folD PE=3 SV=1 14 310 5.0E-15
sp|A8FF15|FOLD_BACP2 Bifunctional protein FolD OS=Bacillus pumilus (strain SAFR-032) GN=folD PE=3 SV=1 38 313 5.0E-15
sp|Q49WI7|FOLD_STAS1 Bifunctional protein FolD OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=folD PE=3 SV=1 10 310 5.0E-15
sp|P18155|MTDC_MOUSE Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Mus musculus GN=Mthfd2 PE=1 SV=1 5 339 5.0E-15
sp|A4SNM0|FOLD_AERS4 Bifunctional protein FolD OS=Aeromonas salmonicida (strain A449) GN=folD PE=3 SV=1 15 310 6.0E-15
sp|A7GSJ9|FOLD_BACCN Bifunctional protein FolD OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=folD PE=3 SV=1 12 210 6.0E-15
sp|Q5LNV2|FOLD1_RUEPO Bifunctional protein FolD 1/3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=folD1 PE=3 SV=1 12 310 7.0E-15
sp|B0SRN4|FOLD_LEPBP Bifunctional protein FolD OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=folD PE=3 SV=1 8 308 7.0E-15
sp|B0S8U6|FOLD_LEPBA Bifunctional protein FolD OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=folD PE=3 SV=1 8 308 7.0E-15
sp|Q83HF0|FOLD_TROW8 Bifunctional protein FolD OS=Tropheryma whipplei (strain TW08/27) GN=folD PE=3 SV=2 11 314 7.0E-15
sp|A5ILJ9|FOLD_THEP1 Bifunctional protein FolD OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=folD PE=3 SV=1 13 313 7.0E-15
sp|Q5P922|FOLD_AROAE Bifunctional protein FolD OS=Aromatoleum aromaticum (strain EbN1) GN=folD PE=3 SV=2 38 312 7.0E-15
sp|A6T5R4|FOLD_KLEP7 Bifunctional protein FolD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=folD PE=3 SV=1 11 313 8.0E-15
sp|B5Y0K4|FOLD_KLEP3 Bifunctional protein FolD OS=Klebsiella pneumoniae (strain 342) GN=folD PE=3 SV=1 11 313 8.0E-15
sp|A7H3N3|FOLD_CAMJD Bifunctional protein FolD OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=folD PE=3 SV=1 19 318 8.0E-15
sp|Q65HI8|FOLD_BACLD Bifunctional protein FolD OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=folD PE=3 SV=1 9 313 8.0E-15
sp|Q14NV1|FOLD_SPICI Bifunctional protein FolD OS=Spiroplasma citri GN=folD PE=3 SV=1 11 312 1.0E-14
sp|C1L2R6|FOLD_LISMC Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=folD PE=3 SV=1 11 313 1.0E-14
sp|Q635A3|FOLD_BACCZ Bifunctional protein FolD OS=Bacillus cereus (strain ZK / E33L) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|Q8Y7C5|FOLD_LISMO Bifunctional protein FolD OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=folD PE=3 SV=1 11 210 1.0E-14
sp|Q6HDY4|FOLD_BACHK Bifunctional protein FolD OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|C1ERQ4|FOLD_BACC3 Bifunctional protein FolD OS=Bacillus cereus (strain 03BB102) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|B7JM32|FOLD_BACC0 Bifunctional protein FolD OS=Bacillus cereus (strain AH820) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|A0RIH3|FOLD_BACAH Bifunctional protein FolD OS=Bacillus thuringiensis (strain Al Hakam) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|Q6MI74|FOLD_BDEBA Bifunctional protein FolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=folD PE=3 SV=1 12 318 1.0E-14
sp|Q81M50|FOLD_BACAN Bifunctional protein FolD OS=Bacillus anthracis GN=folD PE=3 SV=1 12 210 1.0E-14
sp|C3LJV5|FOLD_BACAC Bifunctional protein FolD OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|C3P7W0|FOLD_BACAA Bifunctional protein FolD OS=Bacillus anthracis (strain A0248) GN=folD PE=3 SV=1 12 210 1.0E-14
sp|P0C277|FOLD_NEIMB Bifunctional protein FolD OS=Neisseria meningitidis serogroup B (strain MC58) GN=folD PE=3 SV=1 9 310 1.0E-14
sp|A1VZJ8|FOLD_CAMJJ Bifunctional protein FolD OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=folD PE=3 SV=1 19 318 1.0E-14
sp|A8FLR4|FOLD_CAMJ8 Bifunctional protein FolD OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=folD PE=3 SV=1 19 318 1.0E-14
sp|B8DFW8|FOLD_LISMH Bifunctional protein FolD OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=folD PE=3 SV=1 11 210 2.0E-14
sp|Q9JWI9|FOLD_NEIMA Bifunctional protein FolD OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folD PE=3 SV=1 9 310 2.0E-14
sp|Q1WUJ3|FOLD_LACS1 Bifunctional protein FolD OS=Lactobacillus salivarius (strain UCC118) GN=folD PE=3 SV=1 12 322 2.0E-14
sp|A9M068|FOLD_NEIM0 Bifunctional protein FolD OS=Neisseria meningitidis serogroup C (strain 053442) GN=folD PE=3 SV=2 9 310 2.0E-14
sp|A5W638|FOLD_PSEP1 Bifunctional protein FolD OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=folD PE=3 SV=2 9 310 2.0E-14
sp|A1KWF4|FOLD_NEIMF Bifunctional protein FolD OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=folD PE=3 SV=1 9 310 2.0E-14
sp|Q88KM5|FOLD2_PSEPK Bifunctional protein FolD 2 OS=Pseudomonas putida (strain KT2440) GN=folD2 PE=3 SV=1 9 310 2.0E-14
sp|B0KJG3|FOLD1_PSEPG Bifunctional protein FolD 1 OS=Pseudomonas putida (strain GB-1) GN=folD1 PE=3 SV=1 9 310 2.0E-14
sp|A3N0Q7|FOLD_ACTP2 Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=folD PE=3 SV=1 9 313 2.0E-14
sp|Q7VM86|FOLD_HAEDU Bifunctional protein FolD OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=folD PE=3 SV=1 11 313 2.0E-14
sp|B1HRX9|FOLD_LYSSC Bifunctional protein FolD OS=Lysinibacillus sphaericus (strain C3-41) GN=folD PE=3 SV=1 38 320 2.0E-14
sp|B7IXH2|FOLD_BACC2 Bifunctional protein FolD OS=Bacillus cereus (strain G9842) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|Q31FY5|FOLD2_THICR Bifunctional protein FolD 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=folD2 PE=3 SV=1 9 313 2.0E-14
sp|P54382|FOLD_BACSU Bifunctional protein FolD OS=Bacillus subtilis (strain 168) GN=folD PE=3 SV=1 38 313 2.0E-14
sp|A9AZP9|FOLD_HERA2 Bifunctional protein FolD OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=folD PE=3 SV=1 9 210 2.0E-14
sp|B9IXH4|FOLD_BACCQ Bifunctional protein FolD OS=Bacillus cereus (strain Q1) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|B7HNU4|FOLD_BACC7 Bifunctional protein FolD OS=Bacillus cereus (strain AH187) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|B7HB52|FOLD_BACC4 Bifunctional protein FolD OS=Bacillus cereus (strain B4264) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|Q1ICB3|FOLD_PSEE4 Bifunctional protein FolD OS=Pseudomonas entomophila (strain L48) GN=folD PE=3 SV=1 9 310 2.0E-14
sp|Q731B2|FOLD_BACC1 Bifunctional protein FolD OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|Q818R5|FOLD_BACCR Bifunctional protein FolD OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=folD PE=3 SV=1 12 210 2.0E-14
sp|Q3IRX3|FOLD_NATPD Bifunctional protein FolD OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=folD PE=3 SV=1 11 213 2.0E-14
sp|Q0PA35|FOLD_CAMJE Bifunctional protein FolD OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=folD PE=1 SV=1 19 318 3.0E-14
sp|B1J675|FOLD_PSEPW Bifunctional protein FolD OS=Pseudomonas putida (strain W619) GN=folD PE=3 SV=1 9 310 3.0E-14
sp|A9GW22|FOLD_SORC5 Bifunctional protein FolD OS=Sorangium cellulosum (strain So ce56) GN=folD PE=3 SV=1 11 322 3.0E-14
sp|A4VL74|FOLD_PSEU5 Bifunctional protein FolD OS=Pseudomonas stutzeri (strain A1501) GN=folD PE=3 SV=1 9 310 3.0E-14
sp|B7JVV5|FOLD_CYAP8 Bifunctional protein FolD OS=Cyanothece sp. (strain PCC 8801) GN=folD PE=3 SV=1 9 312 3.0E-14
sp|A0RQ49|FOLD_CAMFF Bifunctional protein FolD OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=folD PE=3 SV=1 38 318 3.0E-14
sp|B0BPI2|FOLD_ACTPJ Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=folD PE=3 SV=1 9 313 3.0E-14
sp|B3GXP3|FOLD_ACTP7 Bifunctional protein FolD OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=folD PE=3 SV=1 9 313 3.0E-14
sp|A0AIG1|FOLD_LISW6 Bifunctional protein FolD OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=folD PE=3 SV=1 11 313 3.0E-14
sp|A9VGW3|FOLD_BACWK Bifunctional protein FolD OS=Bacillus weihenstephanensis (strain KBAB4) GN=folD PE=3 SV=1 12 210 5.0E-14
sp|Q8E168|FOLD_STRA5 Bifunctional protein FolD OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=folD PE=3 SV=1 10 308 5.0E-14
sp|Q8E6M3|FOLD_STRA3 Bifunctional protein FolD OS=Streptococcus agalactiae serotype III (strain NEM316) GN=folD PE=3 SV=1 10 308 5.0E-14
sp|Q3K2M6|FOLD_STRA1 Bifunctional protein FolD OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=folD PE=3 SV=1 10 308 5.0E-14
sp|C1DHE7|FOLD_AZOVD Bifunctional protein FolD OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=folD PE=3 SV=1 9 310 5.0E-14
sp|Q4K9J4|FOLD_PSEF5 Bifunctional protein FolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=folD PE=3 SV=1 9 310 5.0E-14
sp|B8D2H8|FOLD_HALOH Bifunctional protein FolD OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=folD PE=3 SV=1 11 313 6.0E-14
sp|A8AJS4|FOLD_CITK8 Bifunctional protein FolD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=folD PE=3 SV=1 11 313 6.0E-14
sp|A8LWI0|FOLD1_SALAI Bifunctional protein FolD 1 OS=Salinispora arenicola (strain CNS-205) GN=folD1 PE=3 SV=1 9 312 6.0E-14
sp|Q5SJ94|FOLD_THET8 Bifunctional protein FolD OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=folD PE=3 SV=1 9 210 6.0E-14
sp|Q65RF1|FOLD_MANSM Bifunctional protein FolD OS=Mannheimia succiniciproducens (strain MBEL55E) GN=folD PE=3 SV=2 9 310 6.0E-14
sp|Q72JL7|FOLD_THET2 Bifunctional protein FolD OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=folD PE=3 SV=1 9 210 6.0E-14
sp|Q0AB42|FOLD_ALKEH Bifunctional protein FolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=folD PE=3 SV=1 9 310 7.0E-14
sp|A9MLA4|FOLD_SALAR Bifunctional protein FolD OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=folD PE=3 SV=1 11 313 7.0E-14
sp|Q0TPD4|FOLD_CLOP1 Bifunctional protein FolD OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=folD PE=3 SV=1 11 313 8.0E-14
sp|B1WRW8|FOLD_CYAA5 Bifunctional protein FolD OS=Cyanothece sp. (strain ATCC 51142) GN=folD PE=3 SV=1 8 210 9.0E-14
sp|A6Q815|FOLD_SULNB Bifunctional protein FolD OS=Sulfurovum sp. (strain NBC37-1) GN=folD PE=3 SV=1 19 318 9.0E-14
sp|B2GD67|FOLD_LACF3 Bifunctional protein FolD OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=folD PE=3 SV=1 11 314 9.0E-14
sp|B4RQN5|FOLD_NEIG2 Bifunctional protein FolD OS=Neisseria gonorrhoeae (strain NCCP11945) GN=folD PE=3 SV=1 9 310 1.0E-13
sp|Q5F5D0|FOLD_NEIG1 Bifunctional protein FolD OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=folD PE=3 SV=1 9 310 1.0E-13
sp|A1SUX5|FOLD_PSYIN Bifunctional protein FolD OS=Psychromonas ingrahamii (strain 37) GN=folD PE=3 SV=1 9 310 1.0E-13
sp|A4IQS0|FOLD_GEOTN Bifunctional protein FolD OS=Geobacillus thermodenitrificans (strain NG80-2) GN=folD PE=3 SV=1 9 210 1.0E-13
sp|B4U1W4|FOLD_STREM Bifunctional protein FolD OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=folD PE=3 SV=1 11 308 1.0E-13
sp|A3CWL0|FOLD_METMJ Bifunctional protein FolD OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=folD PE=3 SV=1 38 313 1.0E-13
sp|Q3M9M0|FOLD_ANAVT Bifunctional protein FolD OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=folD PE=3 SV=1 1 210 1.0E-13
sp|Q46A53|FOLD_METBF Bifunctional protein FolD OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=folD PE=3 SV=1 11 312 2.0E-13
sp|Q0SS01|FOLD_CLOPS Bifunctional protein FolD OS=Clostridium perfringens (strain SM101 / Type A) GN=folD PE=3 SV=1 11 313 2.0E-13
sp|Q31HQ4|FOLD1_THICR Bifunctional protein FolD 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=folD1 PE=3 SV=2 9 313 2.0E-13
sp|C6DAX0|FOLD_PECCP Bifunctional protein FolD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=folD PE=3 SV=1 11 313 2.0E-13
sp|C0MD36|FOLD_STRS7 Bifunctional protein FolD OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=folD PE=3 SV=1 11 308 2.0E-13
sp|Q4FTX6|FOLD_PSYA2 Bifunctional protein FolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=folD PE=3 SV=1 19 312 2.0E-13
sp|A7ZCH3|FOLD_CAMC1 Bifunctional protein FolD OS=Campylobacter concisus (strain 13826) GN=folD PE=3 SV=1 38 321 2.0E-13
sp|Q836W7|FOLD_ENTFA Bifunctional protein FolD OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=folD PE=3 SV=1 12 312 2.0E-13
sp|Q71ZW2|FOLD_LISMF Bifunctional protein FolD OS=Listeria monocytogenes serotype 4b (strain F2365) GN=folD PE=3 SV=1 11 313 2.0E-13
sp|Q8XJD7|FOLD_CLOPE Bifunctional protein FolD OS=Clostridium perfringens (strain 13 / Type A) GN=folD PE=3 SV=1 11 313 2.0E-13
sp|C0ZC05|FOLD_BREBN Bifunctional protein FolD OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=folD PE=3 SV=1 12 210 2.0E-13
sp|Q2GHD8|FOLD_EHRCR Bifunctional protein FolD OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=folD PE=3 SV=1 12 329 3.0E-13
sp|A1JNX2|FOLD_YERE8 Bifunctional protein FolD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=folD PE=3 SV=1 9 313 3.0E-13
sp|Q6D2E6|FOLD_PECAS Bifunctional protein FolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|B5QUV5|FOLD_SALEP Bifunctional protein FolD OS=Salmonella enteritidis PT4 (strain P125109) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|P58688|FOLD_SALTY Bifunctional protein FolD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=folD PE=3 SV=2 11 313 3.0E-13
sp|Q60006|FOLD_SALTI Bifunctional protein FolD OS=Salmonella typhi GN=folD PE=3 SV=2 11 313 3.0E-13
sp|B4TN64|FOLD_SALSV Bifunctional protein FolD OS=Salmonella schwarzengrund (strain CVM19633) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|B5BCZ5|FOLD_SALPK Bifunctional protein FolD OS=Salmonella paratyphi A (strain AKU_12601) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|C0PVJ3|FOLD_SALPC Bifunctional protein FolD OS=Salmonella paratyphi C (strain RKS4594) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|A9MW26|FOLD_SALPB Bifunctional protein FolD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|Q5PCE5|FOLD_SALPA Bifunctional protein FolD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=folD PE=3 SV=3 11 313 3.0E-13
sp|B4SXP7|FOLD_SALNS Bifunctional protein FolD OS=Salmonella newport (strain SL254) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|B4TA94|FOLD_SALHS Bifunctional protein FolD OS=Salmonella heidelberg (strain SL476) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|B5R6X5|FOLD_SALG2 Bifunctional protein FolD OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|B5FLQ2|FOLD_SALDC Bifunctional protein FolD OS=Salmonella dublin (strain CT_02021853) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|Q57S24|FOLD_SALCH Bifunctional protein FolD OS=Salmonella choleraesuis (strain SC-B67) GN=folD PE=3 SV=3 11 313 3.0E-13
sp|B5EYE2|FOLD_SALA4 Bifunctional protein FolD OS=Salmonella agona (strain SL483) GN=folD PE=3 SV=1 11 313 3.0E-13
sp|Q7NWQ6|FOLD_CHRVO Bifunctional protein FolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=folD PE=3 SV=1 9 310 3.0E-13
sp|Q9I2U6|FOLD_PSEAE Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=folD PE=1 SV=1 9 310 3.0E-13
sp|Q02KT7|FOLD_PSEAB Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=folD PE=3 SV=1 9 310 3.0E-13
sp|B7VB83|FOLD_PSEA8 Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain LESB58) GN=folD PE=3 SV=1 9 310 3.0E-13
sp|C5BI30|FOLD_TERTT Bifunctional protein FolD OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=folD PE=3 SV=1 12 308 3.0E-13
sp|Q1QD30|FOLD_PSYCK Bifunctional protein FolD OS=Psychrobacter cryohalolentis (strain K5) GN=folD PE=3 SV=1 3 312 3.0E-13
sp|Q5WCI9|FOLD_BACSK Bifunctional protein FolD OS=Bacillus clausii (strain KSM-K16) GN=folD PE=3 SV=1 38 312 4.0E-13
sp|A6Q2W6|FOLD_NITSB Bifunctional protein FolD OS=Nitratiruptor sp. (strain SB155-2) GN=folD PE=3 SV=1 41 318 4.0E-13
sp|P09440|C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIS1 PE=1 SV=1 40 318 4.0E-13
sp|Q2NV44|FOLD_SODGM Bifunctional protein FolD OS=Sodalis glossinidius (strain morsitans) GN=folD PE=3 SV=1 11 310 4.0E-13
sp|Q5HAK8|FOLD_EHRRW Bifunctional protein FolD OS=Ehrlichia ruminantium (strain Welgevonden) GN=folD PE=3 SV=1 12 329 5.0E-13
sp|Q167Y9|FOLD1_ROSDO Bifunctional protein FolD 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=folD1 PE=3 SV=1 9 312 5.0E-13
sp|B2UM17|FOLD_AKKM8 Bifunctional protein FolD OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=folD PE=3 SV=1 11 313 5.0E-13
sp|B8F605|FOLD_HAEPS Bifunctional protein FolD OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=folD PE=3 SV=1 9 310 5.0E-13
sp|A4W7J0|FOLD_ENT38 Bifunctional protein FolD OS=Enterobacter sp. (strain 638) GN=folD PE=3 SV=1 11 313 7.0E-13
sp|Q3YRE3|FOLD_EHRCJ Bifunctional protein FolD OS=Ehrlichia canis (strain Jake) GN=folD PE=3 SV=1 12 329 7.0E-13
sp|A4J3F5|FOLD_DESRM Bifunctional protein FolD OS=Desulfotomaculum reducens (strain MI-1) GN=folD PE=3 SV=1 11 313 7.0E-13
sp|Q07ZX6|FOLD_SHEFN Bifunctional protein FolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=folD PE=3 SV=1 9 310 8.0E-13
sp|B0JUP8|FOLD_MICAN Bifunctional protein FolD OS=Microcystis aeruginosa (strain NIES-843) GN=folD PE=3 SV=1 9 310 8.0E-13
sp|B1JHI9|FOLD_YERPY Bifunctional protein FolD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|Q66DK7|FOLD_YERPS Bifunctional protein FolD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|A4TP60|FOLD_YERPP Bifunctional protein FolD OS=Yersinia pestis (strain Pestoides F) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|Q1CKX8|FOLD_YERPN Bifunctional protein FolD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|A9R256|FOLD_YERPG Bifunctional protein FolD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|Q7CJY7|FOLD_YERPE Bifunctional protein FolD OS=Yersinia pestis GN=folD PE=3 SV=1 9 313 8.0E-13
sp|B2K7N4|FOLD_YERPB Bifunctional protein FolD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|Q1C4U4|FOLD_YERPA Bifunctional protein FolD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|A7FL44|FOLD_YERP3 Bifunctional protein FolD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=folD PE=3 SV=1 9 313 8.0E-13
sp|Q8KN38|FOLD_SPHCR Bifunctional protein FolD OS=Sphingobium chlorophenolicum GN=folD PE=3 SV=1 11 210 9.0E-13
sp|Q987T6|FOLD2_RHILO Bifunctional protein FolD 2 OS=Rhizobium loti (strain MAFF303099) GN=folD2 PE=3 SV=1 4 310 1.0E-12
sp|Q3IF52|FOLD_PSEHT Bifunctional protein FolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=folD PE=3 SV=1 9 310 1.0E-12
sp|B2TRN5|FOLD_CLOBB Bifunctional protein FolD OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=folD PE=3 SV=1 41 210 1.0E-12
sp|A7Z6J9|FOLD_BACMF Bifunctional protein FolD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=folD PE=3 SV=1 14 313 1.0E-12
sp|Q9K966|FOLD_BACHD Bifunctional protein FolD OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=folD PE=3 SV=1 38 313 1.0E-12
sp|Q2SRE7|FOLD_MYCCT Bifunctional protein FolD OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=folD PE=3 SV=1 40 314 1.0E-12
sp|A6V726|FOLD_PSEA7 Bifunctional protein FolD OS=Pseudomonas aeruginosa (strain PA7) GN=folD PE=3 SV=1 9 310 1.0E-12
sp|Q48SM7|FOLD_STRPM Bifunctional protein FolD OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=folD PE=3 SV=2 19 308 1.0E-12
sp|Q7CN13|FOLD_STRP8 Bifunctional protein FolD OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=folD PE=3 SV=1 19 308 1.0E-12
sp|Q99YX2|FOLD_STRP1 Bifunctional protein FolD OS=Streptococcus pyogenes serotype M1 GN=folD PE=3 SV=1 19 308 1.0E-12
sp|Q4ZVN1|FOLD1_PSEU2 Bifunctional protein FolD 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=folD1 PE=3 SV=1 9 310 1.0E-12
sp|Q47IX6|FOLD_DECAR Bifunctional protein FolD OS=Dechloromonas aromatica (strain RCB) GN=folD PE=3 SV=1 15 210 1.0E-12
sp|A8YVX0|FOLD_LACH4 Bifunctional protein FolD OS=Lactobacillus helveticus (strain DPC 4571) GN=folD1 PE=3 SV=1 11 314 1.0E-12
sp|B7GHF9|FOLD_ANOFW Bifunctional protein FolD OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=folD PE=3 SV=1 11 210 1.0E-12
sp|A7MJZ6|FOLD_CROS8 Bifunctional protein FolD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=folD PE=3 SV=1 11 313 1.0E-12
sp|C4XLR8|FOLD_DESMR Bifunctional protein FolD OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=folD PE=3 SV=1 12 204 1.0E-12
sp|A0Q0A0|FOLD_CLONN Bifunctional protein FolD OS=Clostridium novyi (strain NT) GN=folD PE=3 SV=1 13 311 2.0E-12
sp|Q1LTX1|FOLD_BAUCH Bifunctional protein FolD OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=folD PE=3 SV=1 11 318 2.0E-12
sp|A5EX57|FOLD_DICNV Bifunctional protein FolD OS=Dichelobacter nodosus (strain VCS1703A) GN=folD PE=3 SV=1 9 314 2.0E-12
sp|Q1J0I3|FOLD2_DEIGD Bifunctional protein FolD 2 OS=Deinococcus geothermalis (strain DSM 11300) GN=folD2 PE=3 SV=1 9 210 2.0E-12
sp|B4S820|FOLD_PROA2 Bifunctional protein FolD OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=folD PE=3 SV=1 12 316 2.0E-12
sp|Q8TK95|FOLD_METAC Bifunctional protein FolD OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=folD PE=3 SV=1 11 312 2.0E-12
sp|A4XTZ3|FOLD1_PSEMY Bifunctional protein FolD 1 OS=Pseudomonas mendocina (strain ymp) GN=folD1 PE=3 SV=1 9 310 2.0E-12
sp|B2V4R7|FOLD_CLOBA Bifunctional protein FolD OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=folD PE=3 SV=1 11 310 2.0E-12
sp|B6YRQ9|FOLD_AZOPC Bifunctional protein FolD OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=folD PE=3 SV=1 25 310 2.0E-12
sp|Q5FG00|FOLD_EHRRG Bifunctional protein FolD OS=Ehrlichia ruminantium (strain Gardel) GN=folD PE=3 SV=1 12 329 2.0E-12
sp|Q6F1V0|FOLD_MESFL Bifunctional protein FolD OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=folD PE=3 SV=1 12 210 2.0E-12
sp|O65271|FOLD4_ARATH Bifunctional protein FolD 4, chloroplastic OS=Arabidopsis thaliana GN=FOLD4 PE=1 SV=1 12 210 2.0E-12
sp|Q8PZQ1|FOLD_METMA Bifunctional protein FolD OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=folD PE=3 SV=1 11 312 2.0E-12
sp|Q6MSL3|FOLD_MYCMS Bifunctional protein FolD OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=folD PE=3 SV=2 25 314 2.0E-12
sp|Q24ZZ6|FOLD1_DESHY Bifunctional protein FolD 1 OS=Desulfitobacterium hafniense (strain Y51) GN=folD1 PE=3 SV=1 11 313 3.0E-12
sp|Q48KZ8|FOLD1_PSE14 Bifunctional protein FolD 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=folD1 PE=3 SV=1 9 217 3.0E-12
sp|Q8Z086|FOLD_NOSS1 Bifunctional protein FolD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=folD PE=3 SV=1 1 210 3.0E-12
sp|A8F7D6|FOLD_PSELT Bifunctional protein FolD OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=folD PE=3 SV=1 12 203 3.0E-12
sp|Q47ZE0|FOLD1_COLP3 Bifunctional protein FolD 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=folD1 PE=3 SV=1 37 312 3.0E-12
sp|B0USU2|FOLD_HISS2 Bifunctional protein FolD OS=Histophilus somni (strain 2336) GN=folD PE=3 SV=1 41 310 3.0E-12
sp|Q8D2W0|FOLD_WIGBR Bifunctional protein FolD OS=Wigglesworthia glossinidia brevipalpis GN=folD PE=3 SV=1 11 317 4.0E-12
sp|Q74IM0|FOLD2_LACJO Bifunctional protein FolD 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=folD2 PE=3 SV=1 15 314 4.0E-12
sp|C5B8V3|FOLD_EDWI9 Bifunctional protein FolD OS=Edwardsiella ictaluri (strain 93-146) GN=folD PE=3 SV=1 11 313 4.0E-12
sp|Q1GE28|FOLD_RUEST Bifunctional protein FolD OS=Ruegeria sp. (strain TM1040) GN=folD PE=3 SV=1 11 312 4.0E-12
sp|Q10X46|FOLD_TRIEI Bifunctional protein FolD OS=Trichodesmium erythraeum (strain IMS101) GN=folD PE=3 SV=1 15 210 4.0E-12
sp|B5XM84|FOLD_STRPZ Bifunctional protein FolD OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=folD PE=3 SV=1 19 308 4.0E-12
sp|P0DF89|FOLD_STRPQ Bifunctional protein FolD OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=folD PE=3 SV=1 19 308 4.0E-12
sp|A2RDM9|FOLD_STRPG Bifunctional protein FolD OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=folD PE=3 SV=1 19 308 4.0E-12
sp|Q1J5U5|FOLD_STRPF Bifunctional protein FolD OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=folD PE=3 SV=2 19 308 4.0E-12
sp|Q1JG29|FOLD_STRPD Bifunctional protein FolD OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=folD PE=3 SV=2 19 308 4.0E-12
sp|Q1JL04|FOLD_STRPC Bifunctional protein FolD OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=folD PE=3 SV=2 19 308 4.0E-12
sp|Q1JAV4|FOLD_STRPB Bifunctional protein FolD OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=folD PE=3 SV=2 19 308 4.0E-12
sp|Q5XB24|FOLD_STRP6 Bifunctional protein FolD OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=folD PE=3 SV=2 19 308 4.0E-12
sp|P0DF88|FOLD_STRP3 Bifunctional protein FolD OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=folD PE=3 SV=1 19 308 4.0E-12
sp|Q044I0|FOLD_LACGA Bifunctional protein FolD OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=folD PE=3 SV=1 11 314 5.0E-12
sp|Q9CJR1|FOLD_PASMU Bifunctional protein FolD OS=Pasteurella multocida (strain Pm70) GN=folD PE=3 SV=1 9 310 5.0E-12
sp|Q6ALZ5|FOLD_DESPS Bifunctional protein FolD OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=folD PE=3 SV=2 9 310 5.0E-12
sp|Q75TC1|FOLD_GEOKA Bifunctional protein FolD OS=Geobacillus kaustophilus (strain HTA426) GN=folD PE=3 SV=1 9 210 5.0E-12
sp|Q21JE9|FOLD_SACD2 Bifunctional protein FolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=folD PE=3 SV=1 12 312 5.0E-12
sp|C5C958|FOLD_MICLC Bifunctional protein FolD OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=folD PE=3 SV=1 9 312 5.0E-12
sp|Q038F9|FOLD_LACC3 Bifunctional protein FolD OS=Lactobacillus casei (strain ATCC 334) GN=folD PE=3 SV=1 16 318 6.0E-12
sp|Q15R43|FOLD_PSEA6 Bifunctional protein FolD OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=folD PE=3 SV=1 13 310 6.0E-12
sp|B5YJV1|FOLD_THEYD Bifunctional protein FolD OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=folD PE=3 SV=1 9 312 7.0E-12
sp|A0JTZ0|FOLD_ARTS2 Bifunctional protein FolD OS=Arthrobacter sp. (strain FB24) GN=folD PE=3 SV=1 8 324 7.0E-12
sp|B1KLT9|FOLD_SHEWM Bifunctional protein FolD OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=folD PE=3 SV=1 9 310 7.0E-12
sp|Q1MPZ8|FOLD_LAWIP Bifunctional protein FolD OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=folD PE=3 SV=1 12 313 7.0E-12
sp|B3WEY4|FOLD_LACCB Bifunctional protein FolD OS=Lactobacillus casei (strain BL23) GN=folD PE=3 SV=1 16 318 8.0E-12
sp|A7NHA9|FOLD_ROSCS Bifunctional protein FolD OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=folD PE=3 SV=1 9 313 8.0E-12
sp|Q87YR0|FOLD1_PSESM Bifunctional protein FolD 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=folD1 PE=3 SV=1 9 217 9.0E-12
sp|B2J442|FOLD_NOSP7 Bifunctional protein FolD OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=folD PE=3 SV=1 1 210 9.0E-12
sp|Q662Y6|FOLD_BORBP Bifunctional protein FolD OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=folD PE=3 SV=1 40 205 1.0E-11
sp|Q0KBW5|FOLD_CUPNH Bifunctional protein FolD OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=folD PE=3 SV=1 11 310 1.0E-11
sp|A1WUN4|FOLD_HALHL Bifunctional protein FolD OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=folD PE=3 SV=1 40 318 1.0E-11
sp|Q67NB1|FOLD_SYMTH Bifunctional protein FolD OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=folD PE=3 SV=1 9 313 1.0E-11
sp|C0R2N7|FOLD_WOLWR Bifunctional protein FolD OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=folD PE=3 SV=1 12 312 1.0E-11
sp|Q0I3S5|FOLD_HAES1 Bifunctional protein FolD OS=Haemophilus somnus (strain 129Pt) GN=folD PE=3 SV=1 41 310 1.0E-11
sp|B1IIW9|FOLD_CLOBK Bifunctional protein FolD OS=Clostridium botulinum (strain Okra / Type B1) GN=folD PE=3 SV=1 41 210 1.0E-11
sp|Q74J95|FOLD1_LACJO Bifunctional protein FolD 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=folD1 PE=3 SV=1 10 215 1.0E-11
sp|Q11UD1|FOLD_CYTH3 Bifunctional protein FolD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=folD PE=3 SV=1 25 316 1.0E-11
sp|C6BSL6|FOLD_DESAD Bifunctional protein FolD OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=folD PE=3 SV=1 14 313 1.0E-11
sp|B0TLV1|FOLD_SHEHH Bifunctional protein FolD OS=Shewanella halifaxensis (strain HAW-EB4) GN=folD PE=3 SV=1 9 310 1.0E-11
sp|A5VAA8|FOLD3_SPHWW Bifunctional protein FolD 3 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=folD3 PE=3 SV=1 10 210 1.0E-11
sp|Q894G6|FOLD_CLOTE Bifunctional protein FolD OS=Clostridium tetani (strain Massachusetts / E88) GN=folD PE=3 SV=2 41 314 1.0E-11
sp|B2S3X1|FOLD_TREPS Bifunctional protein FolD OS=Treponema pallidum subsp. pallidum (strain SS14) GN=folD PE=3 SV=1 11 310 2.0E-11
sp|O83714|FOLD_TREPA Bifunctional protein FolD OS=Treponema pallidum (strain Nichols) GN=folD PE=3 SV=1 11 310 2.0E-11
sp|Q73HK3|FOLD_WOLPM Bifunctional protein FolD OS=Wolbachia pipientis wMel GN=folD PE=3 SV=1 12 312 2.0E-11
sp|A4WQ13|FOLD_RHOS5 Bifunctional protein FolD OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=folD PE=3 SV=1 9 210 2.0E-11
sp|C4LG01|FOLD_TOLAT Bifunctional protein FolD OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=folD PE=3 SV=1 9 313 2.0E-11
sp|B2A532|FOLD_NATTJ Bifunctional protein FolD OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=folD PE=3 SV=1 9 312 2.0E-11
sp|A8G5D8|FOLD_PROM2 Bifunctional protein FolD OS=Prochlorococcus marinus (strain MIT 9215) GN=folD PE=3 SV=1 41 210 2.0E-11
sp|Q3AAY6|FOLD_CARHZ Bifunctional protein FolD OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=folD PE=3 SV=1 13 210 2.0E-11
sp|B3QA91|FOLD_RHOPT Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain TIE-1) GN=folD PE=3 SV=1 9 210 2.0E-11
sp|Q6NCQ6|FOLD_RHOPA Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=folD PE=3 SV=1 9 210 2.0E-11
sp|A1TPZ6|FOLD_ACIAC Bifunctional protein FolD OS=Acidovorax citrulli (strain AAC00-1) GN=folD PE=3 SV=1 9 310 2.0E-11
sp|Q0P5C2|MTDC_BOVIN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Bos taurus GN=MTHFD2 PE=2 SV=1 4 339 2.0E-11
sp|Q8RAD0|FOLD_CALS4 Bifunctional protein FolD OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=folD PE=3 SV=1 12 310 2.0E-11
sp|Q2GLF2|FOLD_ANAPZ Bifunctional protein FolD OS=Anaplasma phagocytophilum (strain HZ) GN=folD PE=3 SV=1 12 312 2.0E-11
sp|Q97HC9|FOLD_CLOAB Bifunctional protein FolD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=folD PE=3 SV=1 32 210 2.0E-11
sp|B4RV70|FOLD_ALTMD Bifunctional protein FolD OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=folD1 PE=3 SV=1 9 310 2.0E-11
sp|A9BIV9|FOLD_PETMO Bifunctional protein FolD OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=folD PE=3 SV=1 22 318 2.0E-11
sp|A7HDC5|FOLD_ANADF Bifunctional protein FolD OS=Anaeromyxobacter sp. (strain Fw109-5) GN=folD PE=3 SV=1 12 285 3.0E-11
sp|A1AXA0|FOLD_RUTMC Bifunctional protein FolD OS=Ruthia magnifica subsp. Calyptogena magnifica GN=folD PE=3 SV=1 12 310 3.0E-11
sp|A6WLP9|FOLD_SHEB8 Bifunctional protein FolD OS=Shewanella baltica (strain OS185) GN=folD PE=3 SV=1 9 310 3.0E-11
sp|A3D303|FOLD_SHEB5 Bifunctional protein FolD OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=folD PE=3 SV=1 9 310 3.0E-11
sp|B8E5F1|FOLD_SHEB2 Bifunctional protein FolD OS=Shewanella baltica (strain OS223) GN=folD PE=3 SV=1 9 310 3.0E-11
sp|B3R4L6|FOLD_CUPTR Bifunctional protein FolD OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=folD PE=3 SV=1 11 310 3.0E-11
sp|Q2JT84|FOLD_SYNJA Bifunctional protein FolD OS=Synechococcus sp. (strain JA-3-3Ab) GN=folD PE=3 SV=1 9 310 3.0E-11
sp|B9M769|FOLD_GEODF Bifunctional protein FolD OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=folD PE=3 SV=1 11 210 3.0E-11
sp|C5CXD8|FOLD_VARPS Bifunctional protein FolD OS=Variovorax paradoxus (strain S110) GN=folD PE=3 SV=1 9 321 3.0E-11
sp|O51057|FOLD_BORBU Bifunctional protein FolD OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=folD PE=3 SV=1 40 205 3.0E-11
sp|P13995|MTDC_HUMAN Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens GN=MTHFD2 PE=1 SV=2 5 339 3.0E-11
sp|B7J0W5|FOLD_BORBZ Bifunctional protein FolD OS=Borrelia burgdorferi (strain ZS7) GN=folD PE=3 SV=1 40 205 4.0E-11
sp|A0B8J7|FOLD_METTP Bifunctional protein FolD OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=folD PE=3 SV=1 12 312 4.0E-11
sp|Q07VM6|FOLD_RHOP5 Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain BisA53) GN=folD PE=3 SV=1 9 210 4.0E-11
sp|Q03LK0|FOLD_STRTD Bifunctional protein FolD OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=folD PE=3 SV=1 12 308 4.0E-11
sp|Q2J3Z0|FOLD_RHOP2 Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain HaA2) GN=folD PE=3 SV=1 9 210 4.0E-11
sp|Q0SPD8|FOLD_BORAP Bifunctional protein FolD OS=Borrelia afzelii (strain PKo) GN=folD PE=3 SV=1 40 205 5.0E-11
sp|B3CLT4|FOLD_WOLPP Bifunctional protein FolD OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=folD PE=3 SV=1 12 310 5.0E-11
sp|Q8EG21|FOLD_SHEON Bifunctional protein FolD OS=Shewanella oneidensis (strain MR-1) GN=folD PE=3 SV=1 9 310 5.0E-11
sp|Q04448|MTDC_DROME Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Drosophila melanogaster GN=Nmdmc PE=2 SV=2 11 207 5.0E-11
sp|Q4JTI3|FOLD_CORJK Bifunctional protein FolD OS=Corynebacterium jeikeium (strain K411) GN=folD PE=3 SV=1 22 312 5.0E-11
sp|A8AW32|FOLD_STRGC Bifunctional protein FolD OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=folD PE=3 SV=1 10 308 5.0E-11
sp|A2BRP7|FOLD_PROMS Bifunctional protein FolD OS=Prochlorococcus marinus (strain AS9601) GN=folD PE=3 SV=1 41 210 6.0E-11
sp|A1RL91|FOLD_SHESW Bifunctional protein FolD OS=Shewanella sp. (strain W3-18-1) GN=folD PE=3 SV=1 9 310 6.0E-11
sp|Q7MIX2|FOLD_VIBVY Bifunctional protein FolD OS=Vibrio vulnificus (strain YJ016) GN=folD PE=3 SV=1 41 310 6.0E-11
sp|Q8DB06|FOLD_VIBVU Bifunctional protein FolD OS=Vibrio vulnificus (strain CMCP6) GN=folD PE=3 SV=1 41 310 6.0E-11
sp|Q3SKX9|FOLD_THIDA Bifunctional protein FolD OS=Thiobacillus denitrificans (strain ATCC 25259) GN=folD PE=3 SV=1 9 310 7.0E-11
sp|B0U009|FOLD_FRAP2 Bifunctional protein FolD OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=folD PE=3 SV=1 38 310 7.0E-11
sp|Q4A6B1|FOLD_MYCS5 Bifunctional protein FolD OS=Mycoplasma synoviae (strain 53) GN=folD PE=3 SV=1 40 314 7.0E-11
sp|Q7M8X1|FOLD_WOLSU Bifunctional protein FolD OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=folD PE=3 SV=1 24 318 7.0E-11
sp|O67736|FOLD_AQUAE Bifunctional protein FolD OS=Aquifex aeolicus (strain VF5) GN=folD PE=3 SV=1 12 313 7.0E-11
sp|Q0HTK5|FOLD_SHESR Bifunctional protein FolD OS=Shewanella sp. (strain MR-7) GN=folD PE=3 SV=1 9 310 7.0E-11
sp|A1VN60|FOLD_POLNA Bifunctional protein FolD OS=Polaromonas naphthalenivorans (strain CJ2) GN=folD PE=3 SV=1 9 310 7.0E-11
sp|Q0HH99|FOLD_SHESM Bifunctional protein FolD OS=Shewanella sp. (strain MR-4) GN=folD PE=3 SV=1 9 310 7.0E-11
sp|A0KYM1|FOLD_SHESA Bifunctional protein FolD OS=Shewanella sp. (strain ANA-3) GN=folD PE=3 SV=1 9 310 7.0E-11
sp|Q13DA7|FOLD_RHOPS Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain BisB5) GN=folD PE=3 SV=1 9 210 7.0E-11
sp|Q12L99|FOLD_SHEDO Bifunctional protein FolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=folD PE=3 SV=1 9 310 8.0E-11
sp|B3EJG9|FOLD_CHLPB Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain BS1) GN=folD PE=3 SV=1 12 313 8.0E-11
sp|A1R451|FOLD2_ARTAT Bifunctional protein FolD 2 OS=Arthrobacter aurescens (strain TC1) GN=folD2 PE=3 SV=1 9 203 8.0E-11
sp|Q2SXF8|FOLD_BURTA Bifunctional protein FolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=folD PE=3 SV=1 38 210 8.0E-11
sp|Q5M583|FOLD_STRT2 Bifunctional protein FolD OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=folD PE=3 SV=2 12 308 8.0E-11
sp|P44313|FOLD_HAEIN Bifunctional protein FolD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folD PE=3 SV=2 10 310 9.0E-11
sp|A5UAS4|FOLD_HAEIE Bifunctional protein FolD OS=Haemophilus influenzae (strain PittEE) GN=folD PE=3 SV=1 10 310 9.0E-11
sp|Q4QMI7|FOLD_HAEI8 Bifunctional protein FolD OS=Haemophilus influenzae (strain 86-028NP) GN=folD PE=3 SV=1 10 310 9.0E-11
sp|A4Y5I0|FOLD_SHEPC Bifunctional protein FolD OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=folD PE=3 SV=1 9 310 9.0E-11
sp|Q6F8N7|FOLD2_ACIAD Bifunctional protein FolD 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=folD2 PE=3 SV=1 12 312 1.0E-10
sp|A9KWH5|FOLD_SHEB9 Bifunctional protein FolD OS=Shewanella baltica (strain OS195) GN=folD PE=3 SV=1 9 310 1.0E-10
sp|A7GCL0|FOLD_CLOBL Bifunctional protein FolD OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=folD PE=3 SV=1 57 210 1.0E-10
sp|Q87RB8|FOLD_VIBPA Bifunctional protein FolD OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=folD PE=3 SV=1 41 310 1.0E-10
sp|A3M846|FOLD_ACIBT Bifunctional protein FolD OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=folD PE=3 SV=2 15 312 1.0E-10
sp|A1S4X3|FOLD_SHEAM Bifunctional protein FolD OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=folD PE=3 SV=1 13 310 1.0E-10
sp|A2BX55|FOLD_PROM5 Bifunctional protein FolD OS=Prochlorococcus marinus (strain MIT 9515) GN=folD PE=3 SV=1 40 210 1.0E-10
sp|B9KLK2|FOLD_RHOSK Bifunctional protein FolD OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=folD PE=3 SV=1 9 210 1.0E-10
sp|Q63SL6|FOLD_BURPS Bifunctional protein FolD OS=Burkholderia pseudomallei (strain K96243) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|A3NBC0|FOLD_BURP6 Bifunctional protein FolD OS=Burkholderia pseudomallei (strain 668) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|Q3JQL8|FOLD_BURP1 Bifunctional protein FolD OS=Burkholderia pseudomallei (strain 1710b) GN=folD PE=3 SV=2 38 210 1.0E-10
sp|Q049N0|FOLD_LACDB Bifunctional protein FolD OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=folD PE=3 SV=1 38 314 1.0E-10
sp|A1V5P2|FOLD_BURMS Bifunctional protein FolD OS=Burkholderia mallei (strain SAVP1) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|Q62IX5|FOLD_BURMA Bifunctional protein FolD OS=Burkholderia mallei (strain ATCC 23344) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|A2SAQ8|FOLD_BURM9 Bifunctional protein FolD OS=Burkholderia mallei (strain NCTC 10229) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|A3MLB7|FOLD_BURM7 Bifunctional protein FolD OS=Burkholderia mallei (strain NCTC 10247) GN=folD PE=3 SV=1 38 210 1.0E-10
sp|Q3J049|FOLD_RHOS4 Bifunctional protein FolD OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=folD PE=3 SV=1 9 210 1.0E-10
sp|A3PM50|FOLD_RHOS1 Bifunctional protein FolD OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=folD PE=3 SV=1 9 210 1.0E-10
sp|Q1G9H1|FOLD_LACDA Bifunctional protein FolD OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=folD PE=3 SV=1 38 314 1.0E-10
sp|A5UHL4|FOLD_HAEIG Bifunctional protein FolD OS=Haemophilus influenzae (strain PittGG) GN=folD PE=3 SV=1 10 310 1.0E-10
sp|A0LLR2|FOLD_SYNFM Bifunctional protein FolD OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=folD PE=3 SV=1 10 313 1.0E-10
sp|Q6LNV7|FOLD_PHOPR Bifunctional protein FolD OS=Photobacterium profundum GN=folD PE=3 SV=1 11 310 1.0E-10
sp|Q5H0S4|FOLD_XANOR Bifunctional protein FolD OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=folD PE=3 SV=1 15 324 1.0E-10
sp|B2SLG3|FOLD_XANOP Bifunctional protein FolD OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=folD PE=3 SV=1 15 324 1.0E-10
sp|Q2P3R1|FOLD_XANOM Bifunctional protein FolD OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=folD PE=3 SV=1 15 324 1.0E-10
sp|Q5GTK9|FOLD_WOLTR Bifunctional protein FolD OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=folD PE=3 SV=1 12 312 1.0E-10
sp|Q74EU7|FOLD2_GEOSL Bifunctional protein FolD 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=folD2 PE=3 SV=1 12 210 1.0E-10
sp|Q0VQ92|FOLD_ALCBS Bifunctional protein FolD OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=folD PE=3 SV=2 9 308 1.0E-10
sp|B8GNT6|FOLD_THISH Bifunctional protein FolD OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=folD PE=3 SV=1 9 318 2.0E-10
sp|C1FKP7|FOLD_CLOBJ Bifunctional protein FolD OS=Clostridium botulinum (strain Kyoto / Type A2) GN=folD PE=3 SV=1 57 210 2.0E-10
sp|Q189R8|FOLD_PEPD6 Bifunctional protein FolD OS=Peptoclostridium difficile (strain 630) GN=folD PE=3 SV=2 15 313 2.0E-10
sp|Q7VGF6|FOLD_HELHP Bifunctional protein FolD OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=folD PE=3 SV=1 38 310 2.0E-10
sp|Q0RI14|FOLD2_FRAAA Bifunctional protein FolD 2 OS=Frankia alni (strain ACN14a) GN=folD2 PE=3 SV=1 12 322 2.0E-10
sp|B1JV19|FOLD_BURCC Bifunctional protein FolD OS=Burkholderia cenocepacia (strain MC0-3) GN=folD PE=3 SV=1 38 210 2.0E-10
sp|A5I112|FOLD_CLOBH Bifunctional protein FolD OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=folD PE=3 SV=1 57 210 2.0E-10
sp|A7FT56|FOLD_CLOB1 Bifunctional protein FolD OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=folD PE=3 SV=1 57 210 2.0E-10
sp|D3YZG8|MTD2L_MOUSE Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 OS=Mus musculus GN=Mthfd2l PE=3 SV=1 12 310 2.0E-10
sp|C4L3F6|FOLD_EXISA Bifunctional protein FolD OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=folD PE=3 SV=1 12 318 2.0E-10
sp|Q8F523|FOLD_LEPIN Bifunctional protein FolD OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=folD PE=3 SV=1 41 308 2.0E-10
sp|Q72QT3|FOLD_LEPIC Bifunctional protein FolD OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=folD PE=3 SV=1 41 308 2.0E-10
sp|Q472L4|FOLD_CUPPJ Bifunctional protein FolD OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=folD PE=3 SV=1 9 310 2.0E-10
sp|Q316P9|FOLD_DESAG Bifunctional protein FolD OS=Desulfovibrio alaskensis (strain G20) GN=folD PE=3 SV=1 12 207 2.0E-10
sp|B0RDR2|FOLD_CLAMS Bifunctional protein FolD OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=folD PE=3 SV=1 38 325 2.0E-10
sp|Q7WJG1|FOLD_BORBR Bifunctional protein FolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=folD PE=3 SV=1 9 312 2.0E-10
sp|Q7VZC8|FOLD1_BORPE Bifunctional protein FolD 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=folD1 PE=3 SV=1 9 312 2.0E-10
sp|Q7WAC0|FOLD1_BORPA Bifunctional protein FolD 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=folD1 PE=3 SV=1 9 312 2.0E-10
sp|Q7MVE9|FOLD_PORGI Bifunctional protein FolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=folD PE=3 SV=1 9 207 2.0E-10
sp|A5V807|FOLD2_SPHWW Bifunctional protein FolD 2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=folD2 PE=3 SV=1 9 318 2.0E-10
sp|B8FLE5|FOLD_DESAA Bifunctional protein FolD OS=Desulfatibacillum alkenivorans (strain AK-01) GN=folD PE=3 SV=1 9 207 2.0E-10
sp|A9NE96|FOLD_ACHLI Bifunctional protein FolD OS=Acholeplasma laidlawii (strain PG-8A) GN=folD PE=3 SV=1 14 210 2.0E-10
sp|Q1D7Y2|FOLD2_MYXXD Bifunctional protein FolD 2 OS=Myxococcus xanthus (strain DK 1622) GN=folD2 PE=3 SV=1 10 310 2.0E-10
sp|Q5L644|FOLD_CHLAB Bifunctional protein FolD OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=folD PE=3 SV=1 18 310 2.0E-10
sp|P96050|FOLD_STRTR Bifunctional protein FolD OS=Streptococcus thermophilus GN=folD PE=3 SV=1 12 308 2.0E-10
sp|Q5M0P7|FOLD_STRT1 Bifunctional protein FolD OS=Streptococcus thermophilus (strain CNRZ 1066) GN=folD PE=3 SV=2 12 308 2.0E-10
sp|Q9LHH7|FOLD2_ARATH Bifunctional protein FolD 2 OS=Arabidopsis thaliana GN=FOLD2 PE=2 SV=1 9 312 2.0E-10
sp|Q21D98|FOLD_RHOPB Bifunctional protein FolD OS=Rhodopseudomonas palustris (strain BisB18) GN=folD PE=3 SV=1 9 210 2.0E-10
sp|A4YK09|FOLD_BRASO Bifunctional protein FolD OS=Bradyrhizobium sp. (strain ORS278) GN=folD PE=3 SV=1 9 210 2.0E-10
sp|A6W1T1|FOLD_MARMS Bifunctional protein FolD OS=Marinomonas sp. (strain MWYL1) GN=folD PE=3 SV=1 9 308 3.0E-10
sp|B9MIU6|FOLD_ACIET Bifunctional protein FolD OS=Acidovorax ebreus (strain TPSY) GN=folD PE=3 SV=1 9 310 3.0E-10
sp|Q3BSP5|FOLD_XANC5 Bifunctional protein FolD OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=folD PE=3 SV=1 15 312 3.0E-10
sp|Q6L046|FOLD_PICTO Bifunctional protein FolD OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=folD PE=3 SV=1 12 210 3.0E-10
sp|B2T5N8|FOLD_BURPP Bifunctional protein FolD OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=folD PE=3 SV=1 38 312 3.0E-10
sp|A3DEE6|FOLD_CLOTH Bifunctional protein FolD OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=folD PE=3 SV=1 41 210 3.0E-10
sp|Q88LI7|FOLD1_PSEPK Bifunctional protein FolD 1 OS=Pseudomonas putida (strain KT2440) GN=folD1 PE=3 SV=1 9 210 3.0E-10
sp|A2C3L3|FOLD_PROM1 Bifunctional protein FolD OS=Prochlorococcus marinus (strain NATL1A) GN=folD PE=3 SV=1 11 210 3.0E-10
sp|A0K8R4|FOLD_BURCH Bifunctional protein FolD OS=Burkholderia cenocepacia (strain HI2424) GN=folD PE=3 SV=1 38 210 3.0E-10
sp|A1BF67|FOLD_CHLPD Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain DSM 266) GN=folD PE=3 SV=2 11 313 3.0E-10
sp|Q1BHV3|FOLD_BURCA Bifunctional protein FolD OS=Burkholderia cenocepacia (strain AU 1054) GN=folD PE=3 SV=1 38 210 3.0E-10
sp|B2V9R3|FOLD_SULSY Bifunctional protein FolD OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=folD PE=3 SV=1 12 314 4.0E-10
sp|C3KT80|FOLD_CLOB6 Bifunctional protein FolD OS=Clostridium botulinum (strain 657 / Type Ba4) GN=folD PE=3 SV=1 57 210 4.0E-10
sp|A5GAM5|FOLD_GEOUR Bifunctional protein FolD OS=Geobacter uraniireducens (strain Rf4) GN=folD PE=3 SV=1 11 318 4.0E-10
sp|A1W7S2|FOLD_ACISJ Bifunctional protein FolD OS=Acidovorax sp. (strain JS42) GN=folD PE=3 SV=1 9 310 4.0E-10
sp|Q89WX9|FOLD_BRADU Bifunctional protein FolD OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=folD PE=3 SV=1 9 313 5.0E-10
sp|A1AL91|FOLD_PELPD Bifunctional protein FolD OS=Pelobacter propionicus (strain DSM 2379) GN=folD PE=3 SV=1 12 310 5.0E-10
sp|B2GM30|FOLD_KOCRD Bifunctional protein FolD OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=folD PE=3 SV=1 9 203 5.0E-10
sp|Q6A6Z2|FOLD_PROAC Bifunctional protein FolD OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=folD PE=3 SV=1 9 317 5.0E-10
sp|A9IQD2|FOLD_BART1 Bifunctional protein FolD OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=folD PE=3 SV=1 12 316 5.0E-10
sp|Q6W210|FOLD_RHISN Bifunctional protein FolD OS=Rhizobium sp. (strain NGR234) GN=folD PE=3 SV=1 10 313 5.0E-10
sp|Q98QV3|FOLD_MYCPU Bifunctional protein FolD OS=Mycoplasma pulmonis (strain UAB CTIP) GN=folD PE=3 SV=1 92 318 5.0E-10
sp|Q5V630|FOLD2_HALMA Bifunctional protein FolD 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folD2 PE=3 SV=1 37 313 5.0E-10
sp|B3ECA6|FOLD_CHLL2 Bifunctional protein FolD OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=folD PE=3 SV=1 12 313 5.0E-10
sp|A3NX53|FOLD_BURP0 Bifunctional protein FolD OS=Burkholderia pseudomallei (strain 1106a) GN=folD PE=3 SV=1 38 210 6.0E-10
sp|Q73RS2|FOLD_TREDE Bifunctional protein FolD OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=folD PE=3 SV=1 9 205 6.0E-10
sp|A6LU44|FOLD_CLOB8 Bifunctional protein FolD OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=folD PE=3 SV=1 11 210 6.0E-10
sp|Q1QQJ9|FOLD_NITHX Bifunctional protein FolD OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=folD PE=3 SV=1 9 210 6.0E-10
sp|A5E8S0|FOLD_BRASB Bifunctional protein FolD OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=folD PE=3 SV=1 9 210 6.0E-10
sp|Q8EQ43|FOLD_OCEIH Bifunctional protein FolD OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=folD PE=3 SV=1 38 313 6.0E-10
sp|Q39ES6|FOLD_BURL3 Bifunctional protein FolD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=folD PE=3 SV=1 38 210 6.0E-10
sp|P51696|FOLD_PHOPO Bifunctional protein FolD OS=Photobacterium phosphoreum GN=folD PE=1 SV=1 9 310 6.0E-10
sp|Q89A92|FOLD_BUCBP Bifunctional protein FolD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folD PE=3 SV=1 11 209 6.0E-10
sp|Q2YC56|FOLD_NITMU Bifunctional protein FolD OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=folD PE=3 SV=1 38 312 6.0E-10
sp|Q3ASI0|FOLD_CHLCH Bifunctional protein FolD OS=Chlorobium chlorochromatii (strain CaD3) GN=folD PE=3 SV=1 12 313 6.0E-10
sp|Q4FNW1|FOLD_PELUB Bifunctional protein FolD OS=Pelagibacter ubique (strain HTCC1062) GN=folD PE=3 SV=1 12 312 6.0E-10
sp|B5FG69|FOLD_VIBFM Bifunctional protein FolD OS=Vibrio fischeri (strain MJ11) GN=folD PE=3 SV=1 9 310 6.0E-10
sp|Q5E3Y1|FOLD_VIBF1 Bifunctional protein FolD OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=folD PE=3 SV=1 9 310 6.0E-10
sp|B6J5U6|FOLD_COXB1 Bifunctional protein FolD OS=Coxiella burnetii (strain CbuK_Q154) GN=folD PE=3 SV=1 11 313 7.0E-10
sp|Q5WX38|FOLD_LEGPL Bifunctional protein FolD OS=Legionella pneumophila (strain Lens) GN=folD PE=3 SV=1 41 310 7.0E-10
sp|A5IBF0|FOLD_LEGPC Bifunctional protein FolD OS=Legionella pneumophila (strain Corby) GN=folD PE=3 SV=1 41 310 7.0E-10
sp|A2SHP8|FOLD_METPP Bifunctional protein FolD OS=Methylibium petroleiphilum (strain PM1) GN=folD PE=3 SV=1 9 210 7.0E-10
sp|A4VTM4|FOLD_STRSY Bifunctional protein FolD OS=Streptococcus suis (strain 05ZYH33) GN=folD PE=3 SV=1 12 310 7.0E-10
sp|A1URL6|FOLD_BARBK Bifunctional protein FolD OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=folD PE=3 SV=1 12 199 7.0E-10
sp|Q5ZVZ1|FOLD_LEGPH Bifunctional protein FolD OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=folD PE=3 SV=1 41 210 7.0E-10
sp|Q8PK86|FOLD_XANAC Bifunctional protein FolD OS=Xanthomonas axonopodis pv. citri (strain 306) GN=folD PE=3 SV=1 15 312 8.0E-10
sp|B6J1Z2|FOLD_COXB2 Bifunctional protein FolD OS=Coxiella burnetii (strain CbuG_Q212) GN=folD PE=3 SV=1 11 313 8.0E-10
sp|B1KZC8|FOLD_CLOBM Bifunctional protein FolD OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=folD PE=3 SV=1 57 210 8.0E-10
sp|Q5ZKA5|MTDC_CHICK Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Gallus gallus GN=MTHFD2 PE=2 SV=1 12 312 8.0E-10
sp|B4EDU1|FOLD_BURCJ Bifunctional protein FolD OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=folD PE=3 SV=1 38 210 8.0E-10
sp|Q21WC0|FOLD_RHOFT Bifunctional protein FolD OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=folD PE=3 SV=1 1 310 9.0E-10
sp|Q050D8|FOLD_LEPBL Bifunctional protein FolD OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=folD PE=3 SV=1 41 308 9.0E-10
sp|Q04SB2|FOLD_LEPBJ Bifunctional protein FolD OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=folD PE=3 SV=1 41 308 9.0E-10
sp|Q2FR55|FOLD_METHJ Bifunctional protein FolD OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=folD PE=3 SV=1 19 210 9.0E-10
sp|A7MT09|FOLD_VIBCB Bifunctional protein FolD OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=folD PE=3 SV=1 41 310 9.0E-10
sp|A4JG19|FOLD_BURVG Bifunctional protein FolD OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=folD PE=3 SV=1 38 210 9.0E-10
sp|B6EIM4|FOLD_ALISL Bifunctional protein FolD OS=Aliivibrio salmonicida (strain LFI1238) GN=folD PE=3 SV=1 9 310 1.0E-09
sp|Q5X5Q9|FOLD_LEGPA Bifunctional protein FolD OS=Legionella pneumophila (strain Paris) GN=folD PE=3 SV=1 25 210 1.0E-09
sp|A1SED2|FOLD1_NOCSJ Bifunctional protein FolD 1 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=folD1 PE=3 SV=1 38 320 1.0E-09
sp|Q83EK7|FOLD_COXBU Bifunctional protein FolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=folD PE=3 SV=1 11 313 1.0E-09
sp|A9NB47|FOLD_COXBR Bifunctional protein FolD OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=folD PE=3 SV=1 11 313 1.0E-09
sp|A9KGQ5|FOLD_COXBN Bifunctional protein FolD OS=Coxiella burnetii (strain Dugway 5J108-111) GN=folD PE=3 SV=1 11 313 1.0E-09
sp|A4SWT5|FOLD_POLSQ Bifunctional protein FolD OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=folD PE=3 SV=1 38 310 1.0E-09
sp|Q13WX0|FOLD_BURXL Bifunctional protein FolD OS=Burkholderia xenovorans (strain LB400) GN=folD PE=3 SV=1 38 312 1.0E-09
sp|A1A171|FOLD_BIFAA Bifunctional protein FolD OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=folD PE=3 SV=1 38 314 1.0E-09
sp|Q9HPY4|FOLD_HALSA Bifunctional protein FolD OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=folD PE=3 SV=1 11 208 2.0E-09
sp|A2RVV7|FOLD1_ARATH Bifunctional protein FolD 1, mitochondrial OS=Arabidopsis thaliana GN=FOLD1 PE=2 SV=1 12 213 2.0E-09
sp|Q823G2|FOLD_CHLCV Bifunctional protein FolD OS=Chlamydophila caviae (strain GPIC) GN=folD PE=3 SV=1 18 310 2.0E-09
sp|Q6F9E6|FOLD1_ACIAD Bifunctional protein FolD 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=folD1 PE=3 SV=1 11 213 2.0E-09
sp|Q24UZ7|FOLD2_DESHY Bifunctional protein FolD 2 OS=Desulfitobacterium hafniense (strain Y51) GN=folD2 PE=3 SV=1 10 210 2.0E-09
sp|Q030A3|FOLD_LACLS Bifunctional protein FolD OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=folD PE=3 SV=2 12 325 2.0E-09
sp|A2RLU5|FOLD_LACLM Bifunctional protein FolD OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=folD PE=3 SV=1 12 325 2.0E-09
sp|Q6G4F1|FOLD_BARHE Bifunctional protein FolD OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=folD PE=3 SV=1 12 316 2.0E-09
sp|Q2RWY4|FOLD_RHORT Bifunctional protein FolD OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=folD PE=3 SV=1 12 210 2.0E-09
sp|Q48HJ1|FOLD2_PSE14 Bifunctional protein FolD 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=folD2 PE=3 SV=1 9 203 2.0E-09
sp|Q8RDM4|FOLD_FUSNN Bifunctional protein FolD OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=folD PE=3 SV=1 12 318 2.0E-09
sp|A3CLQ4|FOLD_STRSV Bifunctional protein FolD OS=Streptococcus sanguinis (strain SK36) GN=folD PE=3 SV=1 10 308 2.0E-09
sp|Q97RI9|FOLD_STRPN Bifunctional protein FolD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=folD PE=3 SV=1 10 285 2.0E-09
sp|Q5FJG5|FOLD_LACAC Bifunctional protein FolD OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=folD PE=3 SV=1 11 210 2.0E-09
sp|B8I761|FOLD_CLOCE Bifunctional protein FolD OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=folD PE=3 SV=1 15 210 3.0E-09
sp|B8HXS0|FOLD_CYAP4 Bifunctional protein FolD OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=folD PE=3 SV=1 12 210 3.0E-09
sp|A9ISZ5|FOLD_BORPD Bifunctional protein FolD OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=folD PE=3 SV=1 7 210 3.0E-09
sp|A1WJ68|FOLD_VEREI Bifunctional protein FolD OS=Verminephrobacter eiseniae (strain EF01-2) GN=folD PE=3 SV=2 9 313 3.0E-09
sp|F6ZFR0|MTD2L_CALJA Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 OS=Callithrix jacchus GN=MTHFD2L PE=3 SV=1 12 310 4.0E-09
sp|A4X776|FOLD1_SALTO Bifunctional protein FolD 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=folD1 PE=3 SV=1 18 312 4.0E-09
sp|A6SVR5|FOLD_JANMA Bifunctional protein FolD OS=Janthinobacterium sp. (strain Marseille) GN=folD PE=3 SV=1 9 210 4.0E-09
sp|Q7W4Z7|FOLD2_BORPA Bifunctional protein FolD 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=folD2 PE=3 SV=2 40 210 4.0E-09
sp|Q2N7E3|FOLD_ERYLH Bifunctional protein FolD OS=Erythrobacter litoralis (strain HTCC2594) GN=folD PE=3 SV=1 9 310 4.0E-09
sp|Q9H903|MTD2L_HUMAN Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 OS=Homo sapiens GN=MTHFD2L PE=2 SV=3 12 310 4.0E-09
sp|Q1RHV0|FOLD_RICBR Bifunctional protein FolD OS=Rickettsia bellii (strain RML369-C) GN=folD PE=3 SV=1 12 210 4.0E-09
sp|Q74GN1|FOLD1_GEOSL Bifunctional protein FolD 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=folD1 PE=3 SV=1 19 310 5.0E-09
sp|Q9PKW1|FOLD_CHLMU Bifunctional protein FolD OS=Chlamydia muridarum (strain MoPn / Nigg) GN=folD PE=3 SV=1 19 310 5.0E-09
sp|Q3A1Q7|FOLD_PELCD Bifunctional protein FolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=folD PE=3 SV=1 9 323 5.0E-09
sp|Q989A7|FOLD1_RHILO Bifunctional protein FolD 1 OS=Rhizobium loti (strain MAFF303099) GN=folD1 PE=3 SV=1 6 210 5.0E-09
sp|A1U1Q5|FOLD_MARHV Bifunctional protein FolD OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=folD PE=3 SV=2 9 310 6.0E-09
sp|A8GW74|FOLD_RICB8 Bifunctional protein FolD OS=Rickettsia bellii (strain OSU 85-389) GN=folD PE=3 SV=1 12 210 6.0E-09
sp|Q8P8Q4|FOLD_XANCP Bifunctional protein FolD OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=folD PE=3 SV=1 15 310 6.0E-09
sp|B0RSB3|FOLD_XANCB Bifunctional protein FolD OS=Xanthomonas campestris pv. campestris (strain B100) GN=folD PE=3 SV=1 15 310 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity Yes
GO:0004486 methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3432
METQAVPKTCKVITAETIAKGLLAEVQQTLAKIQGPDGARPTLVAFLANGDSAAAQYAEWSKKTCEENGFNFDLR
VVDKEQLEEEIMRANDDDDVDGVIVYYPIFPQNPTHDKYIQETVDLSKDVEGLNHKHLYNMYHNVRFLDPPENKK
KSILPCTPLAVVKILEYLQIYNPILAPGNRLFGKTITVINRSEVNGRPLAALLANDGATVFSVDVTGVQLFTRGQ
GIKHPRHHVQDKHGWGLSDCVPVSDVVIGGVPVESFKVPTELIRDGAACINFSSYKNFDGPAIKEKAAIYVPSVG
KVTIAALLRNLVRLVANRPAKEGADEEMLQAKDEAFAND*
Coding >Ophun1|3432
ATGGAGACGCAAGCTGTGCCCAAGACTTGCAAGGTCATCACGGCCGAGACCATCGCCAAGGGCCTCCTCGCCGAG
GTTCAGCAGACGCTGGCCAAGATTCAAGGTCCCGACGGCGCGCGGCCTACGCTCGTCGCTTTTCTCGCCAATGGT
GACTCGGCTGCGGCTCAGTATGCGGAGTGGTCGAAGAAGACGTGCGAGGAAAATGGTTTCAACTTTGATCTTCGC
GTCGTCGACAAGGAGCAGCTCGAAGAGGAGATTATGCGGGCGAACGATGATGACGACGTGGACGGCGTCATCGTC
TACTATCCCATCTTTCCTCAGAATCCCACCCACGACAAGTACATACAGGAGACGGTCGACCTCTCCAAGGACGTC
GAGGGCTTGAATCATAAGCACCTCTACAACATGTACCACAACGTCCGCTTCCTAGACCCTCCCGAGAACAAGAAG
AAGTCGATCCTGCCTTGCACGCCACTAGCCGTGGTCAAGATTCTCGAGTACCTACAGATATACAACCCGATCCTC
GCCCCGGGGAATCGCTTATTCGGCAAGACCATCACCGTCATCAACCGGTCCGAGGTCAACGGACGGCCGCTCGCG
GCGCTGCTGGCCAACGACGGGGCCACGGTATTCTCGGTGGACGTAACGGGCGTCCAACTCTTCACCAGGGGTCAG
GGCATCAAGCATCCGCGACACCATGTTCAAGACAAGCACGGCTGGGGTCTCTCAGACTGCGTGCCGGTCAGCGAC
GTTGTCATTGGCGGCGTGCCGGTCGAGTCCTTCAAGGTGCCGACGGAGCTGATTCGGGATGGGGCGGCCTGCATC
AACTTTTCCTCGTACAAGAACTTTGACGGGCCTGCCATCAAGGAAAAGGCTGCCATCTACGTTCCGTCGGTGGGC
AAGGTGACAATCGCTGCTCTGCTGCGGAATCTTGTACGACTGGTAGCCAATCGGCCCGCGAAGGAGGGCGCGGAC
GAGGAAATGCTGCAGGCCAAGGACGAGGCCTTTGCGAATGACTGA
Transcript >Ophun1|3432
ATGGAGACGCAAGCTGTGCCCAAGACTTGCAAGGTCATCACGGCCGAGACCATCGCCAAGGGCCTCCTCGCCGAG
GTTCAGCAGACGCTGGCCAAGATTCAAGGTCCCGACGGCGCGCGGCCTACGCTCGTCGCTTTTCTCGCCAATGGT
GACTCGGCTGCGGCTCAGTATGCGGAGTGGTCGAAGAAGACGTGCGAGGAAAATGGTTTCAACTTTGATCTTCGC
GTCGTCGACAAGGAGCAGCTCGAAGAGGAGATTATGCGGGCGAACGATGATGACGACGTGGACGGCGTCATCGTC
TACTATCCCATCTTTCCTCAGAATCCCACCCACGACAAGTACATACAGGAGACGGTCGACCTCTCCAAGGACGTC
GAGGGCTTGAATCATAAGCACCTCTACAACATGTACCACAACGTCCGCTTCCTAGACCCTCCCGAGAACAAGAAG
AAGTCGATCCTGCCTTGCACGCCACTAGCCGTGGTCAAGATTCTCGAGTACCTACAGATATACAACCCGATCCTC
GCCCCGGGGAATCGCTTATTCGGCAAGACCATCACCGTCATCAACCGGTCCGAGGTCAACGGACGGCCGCTCGCG
GCGCTGCTGGCCAACGACGGGGCCACGGTATTCTCGGTGGACGTAACGGGCGTCCAACTCTTCACCAGGGGTCAG
GGCATCAAGCATCCGCGACACCATGTTCAAGACAAGCACGGCTGGGGTCTCTCAGACTGCGTGCCGGTCAGCGAC
GTTGTCATTGGCGGCGTGCCGGTCGAGTCCTTCAAGGTGCCGACGGAGCTGATTCGGGATGGGGCGGCCTGCATC
AACTTTTCCTCGTACAAGAACTTTGACGGGCCTGCCATCAAGGAAAAGGCTGCCATCTACGTTCCGTCGGTGGGC
AAGGTGACAATCGCTGCTCTGCTGCGGAATCTTGTACGACTGGTAGCCAATCGGCCCGCGAAGGAGGGCGCGGAC
GAGGAAATGCTGCAGGCCAAGGACGAGGCCTTTGCGAATGACTGA
Gene >Ophun1|3432
ATGGAGACGCAAGCTGTGCCCAAGACTTGCAAGGTCATCACGGCCGAGACCATCGCCAAGGGCCTCCTCGCCGAG
GTTCAGCAGACGCTGGCCAAGATTCAAGGTCCCGACGGCGCGCGGCCTACGCTCGTCGCTTTTCTCGCCAATGGT
GACTCGGCTGCGGCTCAGTATGCGGAGTGGTCGAAGAAGACGTGCGAGGAAAAGTGAGGATGGGTTACGCTGTTT
TCTGGGTGACGTTGCGCAGGACTGATGGTTGGTTGTCAGTGGTTTCAACTTTGATCTTCGCGTCGTCGACAAGGA
GCAGCTCGAAGAGGAGATTATGCGGGCGAACGATGATGACGACGTGGACGGCGTCATCGTCTACTATCCCATCTT
TCCTCAGAATCCCACCCACGACAAGTACATACAGGAGACGGTCGACCTCTCCAAGGACGTCGAGGGCTTGAATCA
TAAGCACCTCTACAACATGTACCACAACGTCCGCTTCCTAGACCCTCCCGAGAACAAGAAGAAGTCGATCCTGCC
TTGCACGCCACTAGCCGTGGTCAAGATTCTCGAGTACCTACAGATATACAACCCGATCCTCGCCCCGGGGAATCG
CTTATTCGGCAAGACCATCACCGTCATCAACCGGTCCGAGGTCAACGGACGGCCGCTCGCGGCGCTGCTGGCCAA
CGACGGGGCCACGGTATTCTCGGTGGACGTAACGGGCGTCCAACTCTTCACCAGGGGTCAGGGCATCAAGCATCC
GCGACACCATGTTCAAGACAAGCACGGCTGGGGTCTCTCAGACTGCGTGCCGGTCAGCGACGTTGTCATTGGCGG
CGTGCCGGTCGAGTCCTTCAAGGTGCCGACGGAGCTGATTCGGGATGGGGCGGCCTGCATCAACTTTTCCTCGTA
CAAGAACTTTGACGGGCCTGCCATCAAGGAAAAGGCTGCCATCTACGTTCCGTCGGTGGGCAAGGTGACAATCGC
TGCTCTGCTGCGGAATCTTGTAGTGAGTCGGCTGTCGAGGGAAAAGTTGCGACGCGCATTTGCTAACGTCGTTCT
GTAGCGACTGGTAGCCAATCGGCCCGCGAAGGAGGGCGCGGACGAGGAAATGCTGCAGGCCAAGGACGAGGCCTT
TGCGAATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail