Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3429
Gene name
LocationContig_304:409..5731
Strand-
Gene length (bp)5322
Transcript length (bp)4986
Coding sequence length (bp)4986
Protein length (aa) 1662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04118 Dopey_N Dopey, N-terminal 1.2E-112 37 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 36 1650 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 37 1634 3.0E-109
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 36 560 2.0E-55
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 35 482 2.0E-48
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 35 482 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 36 1650 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 37 1634 3.0E-109
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 36 560 2.0E-55
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 35 482 2.0E-48
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 35 482 3.0E-48
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 37 457 5.0E-46
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 35 457 6.0E-45
sp|Q9Y3R5|DOP2_HUMAN Protein dopey-2 OS=Homo sapiens GN=DOPEY2 PE=1 SV=5 35 457 1.0E-43
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 37 509 6.0E-42
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 37 512 2.0E-41
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 16 374 1.0E-32
sp|Q5WNI9|PAD1_CAEBR Protein pad-1 OS=Caenorhabditis briggsae GN=pad-1 PE=3 SV=1 16 360 5.0E-30
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 1179 1654 3.0E-25
sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodium falciparum (isolate 3D7) GN=PFC0245c PE=2 SV=1 41 184 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3429
MALEQASGVYSASPESSGRDSPVPRGWRSQDELPVKDKAYRKYASGVEKVLSQFETALEEWADYISFLNRLLKSL
QARPASITTIPAKAVVAKRLSQCLNPALPSGVHQKALEVYSYVFSVIGKEGLSRHIPLYLPGLAPTLSFASLSVR
APFLDLLETHVLRADPRSLRPATKCIILALLPGLEDETSEDFDRTLNIVTGFKKAIRPPDSQHIDQHHSSGDAFF
WQCFFLASMTGHGRRSGALAYLTRCLPILAPVLPSGPPVATSGDEEDDSSKMALVVTSPEPGLLVRCFASGLMDP
QLLIQRGFLDLLVSHLPLNSSVLQSRVKPADLKLLVEAAAGVVTRRDMSLNRRLWAWLLGPEPAGNEGESVGDPT
TPSREQQQQQSLLSPRTNYFEEFGLQPLTKALLDMIKGAASGTAAERARPYRICLSLMDKWEIGGLVVPQVFLPV
VESVRQYQSRAPAKADFAEVLRSASVFFDGIESGLIFSEMFRLLAQALGVESSSMDERTDRISLVAFIVANFNVR
EEDMVTIHGPLTCLAALSMLEHLQTRTSKSGLSASEVVKLSEQALNVIVSLVELVPDRAFPAGRPEAAPSLSMAN
ADILKKLKTFYLELHGNLDSSPPPFEAVECGELLLNKAVEYTYDDGGDGSASSNEDLGLRVRVFTLMLLKTPTSY
RFDVERSMSHLKAQLQQTCPLPFSHLSSVLHLATQLYSAERIDAKQLSEMVGPLVRHAWSYLAVSDPKYHVETVR
CLWQLQTALTPWNREMEAALCSILVDAPVFAEAARTFGVLWSHTLQDTAGDRRAPRTPMHEYRSTPRLSGMEHYP
VMLTQPLFLVLDALLDERTQAYMVVKSWLNNTIGIDRLFLLFVTKLCELSFLSAVGSDGGKSNGADPIIFGRDDD
LDLCLYYLRTLHFVLACTGDVSRSVLASRYLSFGGGQTQIRGSAEEGEMTLQDYFIRVCAECVTGEVASGADQDL
VEQVSQLRRYALMILHQFLSSRHAVSIAHHQLDKVLLDRLAKSISTPDPYVQVLLLEVILDSLKLQEASQGERPP
TATSERMSSVTDRARAGRTSGSVSDSSPVGPQMPPQLLKCLQAGLSCPSSHSVLDSWISFLGDCLPFFAHSIFQM
LIPLVETLCRQIGQTLSDLRNTFQAEPRLAGNGGSAPETALFYLLNGLERVLALAHDQLLTEETRARLLKGPEQT
QSLLGSMVSGVFQSESAQSRSATANDRLTVHLAFQDTMRTCYNIWSWGQGDEARKQDAGSLASFNYTSLRMRNRA
RRLLEHLFAAETLECLETVIGIWRSASGPGERAQVFKFLSALDACRPRHCVPALFNSIYSRTNPGALDPSRKSAM
TIALQDLDLVVFLVEYARSLDDDAMDEIWADCMTFLRDLLGNPFPHRQTLPSLLEFAGILGEKVDNTNFGEQRRM
RRELSDLFLRLLAALFTTRPMTFAEPNGATDKSSSSSINRRRTLSSDSSDDVVRVLASIAPKLPQILVENDRVAS
AAATISTNVMGPALRSRAFPDTLSPRLLRLLLELSRLQGGHRAWKKDVSEAFNDGRFLATRADVVETEWLPLLRQ
WTLADKDRVSEMMSRIGAPTTAGIVFGVGATSARLEADRRTQLNVRRAATLVLASADDGLVSELPLVLDKMTELL
TATPVSHPPST*
Coding >Ophun1|3429
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGCCGCGATTCGCCCGTTCCCCGA
GGCTGGAGGAGTCAAGACGAGCTGCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTGGAGAAGGTT
CTGTCGCAGTTCGAGACGGCTTTGGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGTCTCTA
CAGGCCCGGCCCGCATCCATAACGACGATACCAGCCAAGGCCGTCGTCGCCAAACGTCTATCACAGTGCCTCAAT
CCCGCTCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGGTCTACAGCTACGTCTTTTCCGTCATTGGAAAAGAA
GGCCTGTCTCGGCACATTCCTCTATATCTACCAGGCCTCGCACCCACCCTGTCCTTTGCCTCCCTGTCTGTGAGG
GCGCCCTTTCTCGATCTCTTGGAGACGCATGTCCTGAGAGCCGACCCGCGCTCTCTTCGGCCGGCTACCAAATGC
ATAATATTGGCTTTACTTCCGGGCCTGGAGGACGAAACGAGCGAAGACTTTGATCGCACCCTCAACATCGTCACC
GGCTTCAAGAAAGCTATCCGACCACCGGACAGCCAACATATTGATCAGCATCACTCTTCCGGGGATGCCTTTTTC
TGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGCCGTCGCTCCGGTGCTTTGGCATATCTAACCCGCTGT
CTCCCCATCCTGGCCCCCGTCCTGCCCAGCGGCCCTCCCGTTGCCACCTCTGGAGACGAAGAGGACGACAGCTCC
AAGATGGCGCTCGTCGTGACATCTCCCGAGCCCGGGCTCTTGGTTCGCTGCTTTGCCAGTGGTCTGATGGATCCG
CAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTATCCCATTTACCCCTGAATTCGAGTGTGCTGCAGTCC
CGCGTGAAGCCTGCCGACCTCAAGCTACTTGTCGAGGCTGCCGCCGGAGTGGTGACACGGCGAGACATGAGCTTG
AACAGGCGGCTGTGGGCATGGCTTCTCGGTCCCGAGCCGGCCGGTAATGAAGGCGAGAGTGTGGGGGATCCGACG
ACGCCATCCCGAGAGCAGCAGCAGCAGCAGTCACTCCTCTCGCCCAGGACCAATTACTTTGAGGAGTTCGGGCTG
CAGCCGCTGACCAAGGCCTTGCTGGATATGATCAAGGGGGCTGCCAGCGGCACCGCTGCCGAACGAGCTCGACCA
TACCGCATCTGTCTCTCCCTGATGGACAAGTGGGAGATTGGGGGGCTTGTCGTACCCCAAGTCTTTCTGCCCGTG
GTGGAGAGCGTGAGGCAGTATCAGAGCCGGGCGCCAGCAAAGGCTGATTTTGCCGAGGTCCTGCGCAGTGCCAGC
GTCTTCTTCGACGGCATCGAGAGCGGCCTCATCTTTAGTGAGATGTTCCGGCTACTGGCCCAGGCTCTGGGTGTC
GAGAGCAGCAGCATGGACGAGCGGACCGACAGAATCTCTCTGGTGGCCTTCATCGTGGCAAACTTCAACGTCCGC
GAAGAGGACATGGTGACGATCCACGGCCCTCTCACCTGCCTGGCTGCCCTGTCGATGCTGGAGCACCTACAGACC
CGCACGTCCAAGTCTGGTCTCTCCGCATCCGAGGTGGTCAAGCTCTCTGAGCAGGCTCTGAACGTCATTGTATCG
TTGGTGGAGCTGGTCCCGGACCGCGCATTTCCAGCTGGCCGACCAGAAGCCGCTCCCTCTCTGTCGATGGCAAAC
GCGGATATACTGAAGAAGCTCAAGACGTTCTATCTGGAGCTCCACGGGAACCTCGACTCGTCGCCTCCACCGTTT
GAAGCGGTCGAATGCGGAGAGCTGCTGCTCAACAAGGCCGTCGAATACACGTACGACGATGGCGGTGACGGCTCA
GCATCGTCCAACGAGGACCTGGGCTTACGCGTCCGCGTCTTCACGCTGATGCTTCTCAAGACGCCGACGAGCTAT
AGATTCGACGTTGAAAGGTCCATGTCGCACCTCAAGGCTCAGCTGCAGCAGACGTGCCCGCTGCCCTTTTCCCAT
CTGTCGTCTGTCCTACACCTCGCCACGCAGCTCTACTCGGCCGAGAGGATCGACGCGAAGCAGCTCTCGGAGATG
GTGGGCCCTCTCGTCCGCCACGCGTGGTCTTACCTGGCAGTGTCGGATCCGAAATACCACGTCGAGACGGTCCGT
TGCCTGTGGCAGCTGCAGACGGCCCTCACGCCGTGGAATCGCGAGATGGAAGCCGCCCTGTGCAGCATCCTGGTA
GACGCTCCGGTGTTTGCGGAAGCCGCGCGAACCTTTGGCGTGCTCTGGTCACATACGCTTCAGGACACGGCCGGC
GACCGGCGAGCGCCTCGGACGCCTATGCACGAGTATCGATCTACGCCAAGGCTGTCCGGCATGGAGCATTATCCG
GTCATGCTGACGCAGCCCCTTTTCCTCGTCCTGGACGCGTTGCTGGACGAGCGGACGCAGGCCTACATGGTGGTC
AAGTCGTGGCTCAACAACACCATCGGTATAGACAGGCTCTTCCTTCTCTTCGTCACCAAGCTCTGCGAGTTGTCC
TTTCTCTCGGCCGTCGGGAGCGATGGTGGCAAGTCAAACGGTGCTGATCCCATCATCTTTGGCCGAGACGATGAC
TTGGATCTCTGTCTGTACTATCTGCGGACTCTTCATTTCGTCCTCGCCTGTACTGGCGACGTTTCTCGCTCTGTC
TTGGCGTCCAGATATCTCTCCTTTGGCGGCGGACAGACACAAATACGTGGGAGTGCCGAGGAGGGCGAGATGACG
CTGCAGGACTACTTCATCCGCGTATGCGCTGAATGCGTCACTGGAGAGGTGGCATCTGGTGCCGATCAGGACTTG
GTCGAGCAGGTCTCTCAGCTGCGTCGATACGCGCTGATGATCCTTCATCAGTTCCTGTCGAGCCGCCATGCCGTC
TCCATCGCCCATCATCAGCTCGACAAGGTCCTTTTGGACAGGCTTGCCAAGTCTATCAGTACGCCGGATCCATAC
GTCCAGGTGCTGCTGCTGGAAGTGATACTCGACAGCCTCAAGCTGCAGGAGGCGTCGCAAGGAGAGCGACCACCG
ACGGCGACATCGGAGAGGATGTCTTCGGTGACGGACCGGGCTCGGGCTGGCCGGACGTCAGGCTCCGTGAGCGAC
AGCTCCCCGGTCGGACCGCAGATGCCCCCGCAGCTTCTCAAGTGTCTGCAGGCCGGCCTCAGCTGTCCCAGCAGC
CACTCGGTGCTGGACAGCTGGATATCCTTCTTGGGGGACTGTCTCCCGTTCTTCGCCCACTCCATCTTCCAGATG
CTGATTCCGCTCGTCGAGACGCTCTGCAGACAGATCGGGCAGACGCTGTCGGATCTCCGCAACACGTTCCAGGCG
GAGCCACGGCTGGCCGGCAACGGAGGGAGCGCGCCCGAGACGGCGCTCTTCTACCTGCTCAACGGGCTGGAGCGG
GTGCTGGCACTGGCACACGATCAGCTGCTGACGGAGGAGACGCGAGCGCGGCTGTTGAAGGGGCCCGAGCAGACG
CAGTCTCTCCTGGGAAGCATGGTCTCGGGCGTCTTTCAGTCGGAGAGCGCGCAGTCTCGGAGCGCTACGGCCAAC
GACCGGCTGACGGTGCACCTGGCCTTCCAGGACACGATGAGGACGTGCTACAACATCTGGTCGTGGGGGCAGGGA
GACGAGGCGAGGAAGCAGGACGCTGGCTCTCTGGCGTCGTTCAACTACACGTCTCTCCGGATGAGGAACCGGGCC
CGACGACTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGGTCG
GCGTCCGGGCCGGGCGAGCGAGCGCAGGTCTTCAAGTTCCTGTCGGCCCTGGACGCCTGTCGGCCGAGGCACTGC
GTCCCGGCGCTGTTCAACTCCATCTACAGCCGGACGAACCCGGGCGCGCTGGATCCGTCGCGGAAGTCGGCCATG
ACGATTGCGCTGCAGGACCTGGACCTGGTGGTGTTCCTGGTCGAGTACGCGCGCTCGCTCGACGACGACGCCATG
GACGAGATCTGGGCCGACTGTATGACGTTTCTGCGAGACCTGCTGGGCAACCCGTTCCCTCACCGGCAGACGCTG
CCGAGCCTGCTCGAGTTTGCGGGCATCCTGGGCGAGAAGGTGGACAATACCAACTTTGGAGAGCAGCGGAGGATG
AGACGCGAGCTGAGTGATCTCTTCCTCCGCCTCCTGGCCGCCCTCTTCACGACACGGCCCATGACGTTTGCAGAG
CCCAACGGAGCGACGGATAAGTCGTCGTCGTCATCCATCAACCGGCGAAGGACGTTGAGCAGCGATAGCAGCGAT
GACGTGGTGCGGGTGCTGGCGTCCATCGCGCCCAAGCTGCCGCAGATCCTGGTAGAGAACGACAGGGTGGCATCA
GCAGCAGCCACCATCTCGACCAACGTCATGGGCCCAGCGCTGCGATCGCGAGCCTTCCCAGACACCTTGTCGCCC
CGTCTACTGCGGCTGCTGCTGGAGCTATCACGGCTTCAGGGCGGACACAGGGCATGGAAGAAGGACGTGAGCGAA
GCCTTCAACGACGGTCGATTCCTGGCGACGCGCGCCGACGTCGTCGAGACGGAATGGCTGCCTCTGCTCCGGCAG
TGGACGCTGGCGGACAAGGACCGCGTCTCCGAGATGATGAGCCGAATCGGAGCCCCGACAACCGCCGGCATCGTC
TTCGGCGTCGGCGCCACCTCGGCCCGGCTCGAAGCCGATCGCCGGACCCAACTCAACGTCCGACGAGCAGCAACG
CTGGTGCTCGCATCCGCCGACGACGGACTCGTCTCGGAACTACCCCTGGTGCTGGACAAGATGACGGAACTGCTA
ACAGCAACGCCCGTCTCACATCCCCCGTCCACCTAG
Transcript >Ophun1|3429
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGCCGCGATTCGCCCGTTCCCCGA
GGCTGGAGGAGTCAAGACGAGCTGCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTGGAGAAGGTT
CTGTCGCAGTTCGAGACGGCTTTGGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGTCTCTA
CAGGCCCGGCCCGCATCCATAACGACGATACCAGCCAAGGCCGTCGTCGCCAAACGTCTATCACAGTGCCTCAAT
CCCGCTCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGGTCTACAGCTACGTCTTTTCCGTCATTGGAAAAGAA
GGCCTGTCTCGGCACATTCCTCTATATCTACCAGGCCTCGCACCCACCCTGTCCTTTGCCTCCCTGTCTGTGAGG
GCGCCCTTTCTCGATCTCTTGGAGACGCATGTCCTGAGAGCCGACCCGCGCTCTCTTCGGCCGGCTACCAAATGC
ATAATATTGGCTTTACTTCCGGGCCTGGAGGACGAAACGAGCGAAGACTTTGATCGCACCCTCAACATCGTCACC
GGCTTCAAGAAAGCTATCCGACCACCGGACAGCCAACATATTGATCAGCATCACTCTTCCGGGGATGCCTTTTTC
TGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGCCGTCGCTCCGGTGCTTTGGCATATCTAACCCGCTGT
CTCCCCATCCTGGCCCCCGTCCTGCCCAGCGGCCCTCCCGTTGCCACCTCTGGAGACGAAGAGGACGACAGCTCC
AAGATGGCGCTCGTCGTGACATCTCCCGAGCCCGGGCTCTTGGTTCGCTGCTTTGCCAGTGGTCTGATGGATCCG
CAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTATCCCATTTACCCCTGAATTCGAGTGTGCTGCAGTCC
CGCGTGAAGCCTGCCGACCTCAAGCTACTTGTCGAGGCTGCCGCCGGAGTGGTGACACGGCGAGACATGAGCTTG
AACAGGCGGCTGTGGGCATGGCTTCTCGGTCCCGAGCCGGCCGGTAATGAAGGCGAGAGTGTGGGGGATCCGACG
ACGCCATCCCGAGAGCAGCAGCAGCAGCAGTCACTCCTCTCGCCCAGGACCAATTACTTTGAGGAGTTCGGGCTG
CAGCCGCTGACCAAGGCCTTGCTGGATATGATCAAGGGGGCTGCCAGCGGCACCGCTGCCGAACGAGCTCGACCA
TACCGCATCTGTCTCTCCCTGATGGACAAGTGGGAGATTGGGGGGCTTGTCGTACCCCAAGTCTTTCTGCCCGTG
GTGGAGAGCGTGAGGCAGTATCAGAGCCGGGCGCCAGCAAAGGCTGATTTTGCCGAGGTCCTGCGCAGTGCCAGC
GTCTTCTTCGACGGCATCGAGAGCGGCCTCATCTTTAGTGAGATGTTCCGGCTACTGGCCCAGGCTCTGGGTGTC
GAGAGCAGCAGCATGGACGAGCGGACCGACAGAATCTCTCTGGTGGCCTTCATCGTGGCAAACTTCAACGTCCGC
GAAGAGGACATGGTGACGATCCACGGCCCTCTCACCTGCCTGGCTGCCCTGTCGATGCTGGAGCACCTACAGACC
CGCACGTCCAAGTCTGGTCTCTCCGCATCCGAGGTGGTCAAGCTCTCTGAGCAGGCTCTGAACGTCATTGTATCG
TTGGTGGAGCTGGTCCCGGACCGCGCATTTCCAGCTGGCCGACCAGAAGCCGCTCCCTCTCTGTCGATGGCAAAC
GCGGATATACTGAAGAAGCTCAAGACGTTCTATCTGGAGCTCCACGGGAACCTCGACTCGTCGCCTCCACCGTTT
GAAGCGGTCGAATGCGGAGAGCTGCTGCTCAACAAGGCCGTCGAATACACGTACGACGATGGCGGTGACGGCTCA
GCATCGTCCAACGAGGACCTGGGCTTACGCGTCCGCGTCTTCACGCTGATGCTTCTCAAGACGCCGACGAGCTAT
AGATTCGACGTTGAAAGGTCCATGTCGCACCTCAAGGCTCAGCTGCAGCAGACGTGCCCGCTGCCCTTTTCCCAT
CTGTCGTCTGTCCTACACCTCGCCACGCAGCTCTACTCGGCCGAGAGGATCGACGCGAAGCAGCTCTCGGAGATG
GTGGGCCCTCTCGTCCGCCACGCGTGGTCTTACCTGGCAGTGTCGGATCCGAAATACCACGTCGAGACGGTCCGT
TGCCTGTGGCAGCTGCAGACGGCCCTCACGCCGTGGAATCGCGAGATGGAAGCCGCCCTGTGCAGCATCCTGGTA
GACGCTCCGGTGTTTGCGGAAGCCGCGCGAACCTTTGGCGTGCTCTGGTCACATACGCTTCAGGACACGGCCGGC
GACCGGCGAGCGCCTCGGACGCCTATGCACGAGTATCGATCTACGCCAAGGCTGTCCGGCATGGAGCATTATCCG
GTCATGCTGACGCAGCCCCTTTTCCTCGTCCTGGACGCGTTGCTGGACGAGCGGACGCAGGCCTACATGGTGGTC
AAGTCGTGGCTCAACAACACCATCGGTATAGACAGGCTCTTCCTTCTCTTCGTCACCAAGCTCTGCGAGTTGTCC
TTTCTCTCGGCCGTCGGGAGCGATGGTGGCAAGTCAAACGGTGCTGATCCCATCATCTTTGGCCGAGACGATGAC
TTGGATCTCTGTCTGTACTATCTGCGGACTCTTCATTTCGTCCTCGCCTGTACTGGCGACGTTTCTCGCTCTGTC
TTGGCGTCCAGATATCTCTCCTTTGGCGGCGGACAGACACAAATACGTGGGAGTGCCGAGGAGGGCGAGATGACG
CTGCAGGACTACTTCATCCGCGTATGCGCTGAATGCGTCACTGGAGAGGTGGCATCTGGTGCCGATCAGGACTTG
GTCGAGCAGGTCTCTCAGCTGCGTCGATACGCGCTGATGATCCTTCATCAGTTCCTGTCGAGCCGCCATGCCGTC
TCCATCGCCCATCATCAGCTCGACAAGGTCCTTTTGGACAGGCTTGCCAAGTCTATCAGTACGCCGGATCCATAC
GTCCAGGTGCTGCTGCTGGAAGTGATACTCGACAGCCTCAAGCTGCAGGAGGCGTCGCAAGGAGAGCGACCACCG
ACGGCGACATCGGAGAGGATGTCTTCGGTGACGGACCGGGCTCGGGCTGGCCGGACGTCAGGCTCCGTGAGCGAC
AGCTCCCCGGTCGGACCGCAGATGCCCCCGCAGCTTCTCAAGTGTCTGCAGGCCGGCCTCAGCTGTCCCAGCAGC
CACTCGGTGCTGGACAGCTGGATATCCTTCTTGGGGGACTGTCTCCCGTTCTTCGCCCACTCCATCTTCCAGATG
CTGATTCCGCTCGTCGAGACGCTCTGCAGACAGATCGGGCAGACGCTGTCGGATCTCCGCAACACGTTCCAGGCG
GAGCCACGGCTGGCCGGCAACGGAGGGAGCGCGCCCGAGACGGCGCTCTTCTACCTGCTCAACGGGCTGGAGCGG
GTGCTGGCACTGGCACACGATCAGCTGCTGACGGAGGAGACGCGAGCGCGGCTGTTGAAGGGGCCCGAGCAGACG
CAGTCTCTCCTGGGAAGCATGGTCTCGGGCGTCTTTCAGTCGGAGAGCGCGCAGTCTCGGAGCGCTACGGCCAAC
GACCGGCTGACGGTGCACCTGGCCTTCCAGGACACGATGAGGACGTGCTACAACATCTGGTCGTGGGGGCAGGGA
GACGAGGCGAGGAAGCAGGACGCTGGCTCTCTGGCGTCGTTCAACTACACGTCTCTCCGGATGAGGAACCGGGCC
CGACGACTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGGTCG
GCGTCCGGGCCGGGCGAGCGAGCGCAGGTCTTCAAGTTCCTGTCGGCCCTGGACGCCTGTCGGCCGAGGCACTGC
GTCCCGGCGCTGTTCAACTCCATCTACAGCCGGACGAACCCGGGCGCGCTGGATCCGTCGCGGAAGTCGGCCATG
ACGATTGCGCTGCAGGACCTGGACCTGGTGGTGTTCCTGGTCGAGTACGCGCGCTCGCTCGACGACGACGCCATG
GACGAGATCTGGGCCGACTGTATGACGTTTCTGCGAGACCTGCTGGGCAACCCGTTCCCTCACCGGCAGACGCTG
CCGAGCCTGCTCGAGTTTGCGGGCATCCTGGGCGAGAAGGTGGACAATACCAACTTTGGAGAGCAGCGGAGGATG
AGACGCGAGCTGAGTGATCTCTTCCTCCGCCTCCTGGCCGCCCTCTTCACGACACGGCCCATGACGTTTGCAGAG
CCCAACGGAGCGACGGATAAGTCGTCGTCGTCATCCATCAACCGGCGAAGGACGTTGAGCAGCGATAGCAGCGAT
GACGTGGTGCGGGTGCTGGCGTCCATCGCGCCCAAGCTGCCGCAGATCCTGGTAGAGAACGACAGGGTGGCATCA
GCAGCAGCCACCATCTCGACCAACGTCATGGGCCCAGCGCTGCGATCGCGAGCCTTCCCAGACACCTTGTCGCCC
CGTCTACTGCGGCTGCTGCTGGAGCTATCACGGCTTCAGGGCGGACACAGGGCATGGAAGAAGGACGTGAGCGAA
GCCTTCAACGACGGTCGATTCCTGGCGACGCGCGCCGACGTCGTCGAGACGGAATGGCTGCCTCTGCTCCGGCAG
TGGACGCTGGCGGACAAGGACCGCGTCTCCGAGATGATGAGCCGAATCGGAGCCCCGACAACCGCCGGCATCGTC
TTCGGCGTCGGCGCCACCTCGGCCCGGCTCGAAGCCGATCGCCGGACCCAACTCAACGTCCGACGAGCAGCAACG
CTGGTGCTCGCATCCGCCGACGACGGACTCGTCTCGGAACTACCCCTGGTGCTGGACAAGATGACGGAACTGCTA
ACAGCAACGCCCGTCTCACATCCCCCGTCCACCTAG
Gene >Ophun1|3429
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGCCGCGATTCGCCCGTTCCCCGA
GGCTGGAGGAGTCAAGGTGGGCGCCCTGCCAGCGCTGTCGCCCATCTCTATCTGACCCGAAGATGCAGACGAGCT
GCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTGGAGAAGGTTCTGTCGCAGTTCGAGACGGCTTT
GGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGGTATTGACCAGCTGCCCCTTCAATCAAGA
GCTCATGGCGCTCATCATCTACGATTTAGTCTCTACAGGCCCGGCCCGCATCCATAACGACGATACCAGCCAAGG
CCGTCGTCGCCAAACGTCTATCACAGTGCCTCAATCCCGCTCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGG
TCTACAGCTACGTCTTTTCCGTCATTGGAAAAGAAGGCCTGTCTCGGCACATTCCTCTATATCTACCAGGCCTCG
CACCCACCCTGTCCTTTGCCTCCCTGTCTGTGAGGGCGCCCTTTCTCGATCTCTTGGAGACGCATGTCCTGAGAG
CCGACCCGCGCTCTCTTCGGCCGGCTACCAAATGCATAATATTGGCTTTACTTCCGGGCCTGGAGGACGAAACGA
GCGAAGACTTTGATCGCACCCTCAACATCGTCACCGGCTTCAAGAAAGCTATCCGACCACCGGACAGCCAACATA
TTGATCAGCATCACTCTTCCGGGGATGCCTTTTTCTGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGCC
GTCGCTCCGGTGCTTTGGCATATCTAACCCGCTGTCTCCCCATCCTGGCCCCCGTCCTGCCCAGCGGCCCTCCCG
TTGCCACCTCTGGAGACGAAGAGGACGACAGCTCCAAGATGGCGCTCGTCGTGACATCTCCCGAGCCCGGGCTCT
TGGTTCGCTGCTTTGCCAGTGGTCTGATGGATCCGCAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTAT
CCCATTTACCCCTGAATTCGAGTGTGCTGCAGTCCCGCGTGAAGCCTGCCGACCTCAAGCTACTTGTCGAGGCTG
CCGCCGGAGTGGTGACACGGCGAGACATGAGCTTGAACAGGCGGCTGTGGGCATGGCTTCTCGGTCCCGAGCCGG
CCGGTAATGAAGGCGAGAGTGTGGGGGATCCGACGACGCCATCCCGAGAGCAGCAGCAGCAGCAGTCACTCCTCT
CGCCCAGGACCAATTACTTTGAGGAGTTCGGGCTGCAGCCGCTGACCAAGGCCTTGCTGGATATGATCAAGGGGG
CTGCCAGCGGCACCGCTGCCGAACGAGCTCGACCATACCGCATCTGTCTCTCCCTGATGGACAAGTGGGAGATTG
GGGGGCTTGTCGTACCCCAAGTCTTTCTGCCCGTGGTGGAGAGCGTGAGGCAGTATCAGAGCCGGGCGCCAGCAA
AGGCTGATTTTGCCGAGGTCCTGCGCAGTGCCAGCGTCTTCTTCGACGGCATCGAGAGCGGCCTCATCTTTAGTG
AGATGTTCCGGCTACTGGCCCAGGCTCTGGGTGTCGAGAGCAGCAGCATGGACGAGCGGACCGACAGAATCTCTC
TGGTGGCCTTCATCGTGGCAAACTTCAACGTCCGCGAAGAGGACATGGTGACGATCCACGGCCCTCTCACCTGCC
TGGCTGCCCTGTCGATGCTGGAGCACCTACAGACCCGCACGTCCAAGTCTGGTCTCTCCGCATCCGAGGTGGTCA
AGCTCTCTGAGCAGGCTCTGAACGTCATTGTATCGTTGGTGGAGCTGGTCCCGGACCGCGCATTTCCAGCTGGCC
GACCAGAAGCCGCTCCCTCTCTGTCGATGGCAAACGCGGATATACTGAAGAAGCTCAAGACGTTCTATCTGGAGC
TCCACGGGAACCTCGACTCGTCGCCTCCACCGTTTGAAGCGGTCGAATGCGGAGAGCTGCTGCTCAACAAGGCCG
TCGAATACACGTACGACGATGGCGGTGACGGCTCAGCATCGTCCAACGAGGACCTGGGCTTACGCGTCCGCGTCT
TCACGCTGATGCTTCTCAAGACGCCGACGAGCTATAGATTCGACGTTGAAAGGTCCATGTCGCACCTCAAGGCTC
AGCTGCAGCAGACGTGCCCGCTGCCCTTTTCCCATCTGTCGTCTGTCCTACACCTCGCCACGCAGCTCTACTCGG
CCGAGAGGATCGACGCGAAGCAGCTCTCGGAGATGGTGGGCCCTCTCGTCCGCCACGCGTGGTCTTACCTGGCAG
TGTCGGATCCGAAATACCACGTCGAGACGGTCCGTTGCCTGTGGCAGCTGCAGACGGCCCTCACGCCGTGGAATC
GCGAGATGGAAGCCGCCCTGTGCAGCATCCTGGTAGACGCTCCGGTGTTTGCGGAAGCCGCGCGAACCTTTGGCG
TGCTCTGGTCACATACGCTTCAGGACACGGCCGGCGACCGGCGAGCGCCTCGGACGCCTATGCACGAGTATCGAT
CTACGCCAAGGCTGTCCGGCATGGAGCATTATCCGGTCATGCTGACGCAGCCCCTTTTCCTCGTCCTGGACGCGT
TGCTGGACGAGCGGACGCAGGCCTACATGGTGGTCAAGTCGTGGCTCAACAACACCATCGGTATAGACAGGTAAG
AGGGCACTGGTTTGTTCTGGGCGTACTGCTCGTTGTTGACTGTCTGTAGGCTCTTCCTTCTCTTCGTCACCAAGC
TCTGCGAGTTGTCCTTTCTCTCGGCCGTCGGGAGCGATGGTGGCAAGTCAAACGGTGCTGATCCCATCATCTTTG
GCCGAGACGATGACTTGGATCTCTGTCTGTACTATCTGCGGACTCTTCATTTCGTCCTCGCCTGTACTGGCGACG
TTTCTCGCTCTGTCTTGGCGTCCAGATATCTCTCCTTTGGCGGCGGACAGACACAAATACGTGGTACATCGTTCC
CATTCCTGCTGTGCGGACAAGTGACGCTTACACTGTTGTCAGGGAGTGCCGAGGAGGGCGAGATGACGCTGCAGG
ACTACTTCATCCGCGTATGCGCTGAATGCGTCACTGGAGAGGTGGCATCTGGTGCCGATCAGGACTTGGTCGAGC
AGGTCTCTCAGCTGCGTCGATACGCGCTGATGATCCTTCATCAGTTCCTGTCGAGCCGCCATGCCGTCTCCATCG
CCCATCATCAGCTCGACAAGGTCCTTTTGGACAGGCTTGCCAAGTCTATCAGTACGCCGGATCCATACGTCCAGG
TGCTGCTGCTGGAAGTGATACTCGACAGCCTCAAGCTGCAGGAGGCGTCGCAAGGAGAGCGACCACCGACGGCGA
CATCGGAGAGGATGTCTTCGGTGACGGACCGGGCTCGGGCTGGCCGGACGTCAGGCTCCGTGAGCGACAGCTCCC
CGGTCGGACCGCAGATGCCCCCGCAGCTTCTCAAGTGTCTGCAGGCCGGCCTCAGCTGTCCCAGCAGCCACTCGG
TGCTGGACAGCTGGATATCCTTCTTGGGGGACTGTCTCCCGTTCTTCGCCCACTCCATCTTCCAGATGCTGATTC
CGCTCGTCGAGACGCTCTGCAGACAGATCGGGCAGACGCTGTCGGATCTCCGCAACACGTTCCAGGCGGAGCCAC
GGCTGGCCGGCAACGGAGGGAGCGCGCCCGAGACGGCGCTCTTCTACCTGCTCAACGGGCTGGAGCGGGTGCTGG
CACTGGCACACGATCAGCTGCTGACGGAGGAGACGCGAGCGCGGCTGTTGAAGGGGCCCGAGCAGACGCAGTCTC
TCCTGGGAAGCATGGTCTCGGGCGTCTTTCAGTCGGAGAGCGCGCAGTCTCGGAGCGCTACGGCCAACGACCGGC
TGACGGTGCACCTGGCCTTCCAGGACACGATGAGGACGTGCTACAACATCTGGTCGTGGGGGCAGGGAGACGAGG
CGAGGAAGCAGGACGCTGGCTCTCTGGCGTCGTTCAACTACACGTCTCTCCGGATGAGGAACCGGGCCCGACGAC
TGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGGTCGGCGTCCG
GGCCGGGCGAGCGAGCGCAGGTCTTCAAGTTCCTGTCGGCCCTGGACGCCTGTCGGCCGAGGCACTGCGTCCCGG
CGCTGTTCAACTCCATCTACAGCCGGACGAACCCGGGCGCGCTGGATCCGTCGCGGAAGTCGGCCATGACGATTG
CGCTGCAGGACCTGGACCTGGTGGTGTTCCTGGTCGAGTACGCGCGCTCGCTCGACGACGACGCCATGGACGAGA
TCTGGGCCGACTGTATGACGTTTCTGCGAGACCTGCTGGGCAACCCGTTCCCTCACCGGCAGACGCTGCCGAGCC
TGCTCGAGTTTGCGGGCATCCTGGGCGAGAAGGTGGACAATACCAACTTTGGAGAGCAGCGGAGGATGAGACGCG
AGCTGAGTGTCGGTTCATACGAGTCCCTTTTATCCGAGTTGAGACAGGTGAACTGACGTCAATAGGATCTCTTCC
TCCGCCTCCTGGCCGCCCTCTTCACGACACGGCCCATGACGTTTGCAGAGCCCAACGGAGCGACGGATAAGTCGT
CGTCGTCATCCATCAACCGGCGAAGGACGTTGAGCAGCGATAGCAGCGATGACGTGGTGCGGGTGCTGGCGTCCA
TCGCGCCCAAGCTGCCGCAGATCCTGGTAGAGAACGACAGGGTGGCATCAGCAGCAGCCACCATCTCGACCAACG
TCATGGGCCCAGCGCTGCGATCGCGAGCCTTCCCAGACACCTTGTCGCCCCGTCTACTGCGGCTGCTGCTGGAGC
TATCACGGCTTCAGGGCGGACACAGGGCATGGAAGAAGGACGTGAGCGAAGCCTTCAACGACGGTCGATTCCTGG
CGACGCGCGCCGACGTCGTCGAGACGGAATGGCTGCCTCTGCTCCGGCAGTGGACGCTGGCGGACAAGGACCGCG
TCTCCGAGATGATGAGCCGAATCGGAGCCCCGACAACCGCCGGCATCGTCTTCGGCGTCGGCGCCACCTCGGCCC
GGCTCGAAGCCGATCGCCGGACCCAACTCAACGTCCGACGAGCAGCAACGCTGGTGCTCGCATCCGCCGACGACG
GACTCGTCTCGGAACTACCCCTGGTGCTGGACAAGATGACGGAACTGCTAACAGCAACGCCCGTCTCGTCCCCCT
CGTCAACCACCCGAGCAGACGTCTTCCAGCTCGTCCGCGCCCTCGCCCTCAAGACATCCCCCGTCCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail