Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3427
Gene name
LocationContig_303:17779..18895
Strand-
Gene length (bp)1116
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase 4.1E-105 70 329
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 6.2E-09 76 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 28 351 1.0E-160
sp|Q311U7|PANB_DESAG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=panB PE=3 SV=1 86 348 1.0E-87
sp|O82357|PANB1_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=KPHMT1 PE=1 SV=1 52 351 1.0E-86
sp|Q3A9L0|PANB_CARHZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=panB PE=3 SV=1 70 336 1.0E-86
sp|Q9M315|PANB2_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=KPHMT2 PE=1 SV=1 52 351 2.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 28 351 1.0E-160
sp|Q311U7|PANB_DESAG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=panB PE=3 SV=1 86 348 1.0E-87
sp|O82357|PANB1_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=KPHMT1 PE=1 SV=1 52 351 1.0E-86
sp|Q3A9L0|PANB_CARHZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=panB PE=3 SV=1 70 336 1.0E-86
sp|Q9M315|PANB2_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=KPHMT2 PE=1 SV=1 52 351 2.0E-86
sp|Q9AWZ7|PANB2_ORYSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=KPHMT2 PE=3 SV=1 70 349 6.0E-86
sp|Q9AWZ8|PANB1_ORYSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=KPHMT1 PE=2 SV=1 70 351 3.0E-83
sp|A1VBJ4|PANB_DESVV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=panB PE=3 SV=1 54 344 6.0E-83
sp|Q729A6|PANB_DESVH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=panB PE=3 SV=1 54 344 6.0E-83
sp|A0LLW3|PANB_SYNFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=panB PE=3 SV=1 86 340 5.0E-82
sp|Q3Z8B4|PANB_DEHM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=panB PE=3 SV=2 70 348 6.0E-82
sp|Q2LTJ5|PANB_SYNAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=panB PE=3 SV=2 65 334 2.0E-81
sp|B0TC10|PANB_HELMI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=panB PE=3 SV=1 70 336 6.0E-81
sp|Q3ZXG0|PANB_DEHMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=panB PE=3 SV=1 70 348 7.0E-81
sp|B0K365|PANB_THEPX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=panB PE=3 SV=1 70 340 8.0E-81
sp|B0KC90|PANB_THEP3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=panB PE=3 SV=1 70 340 8.0E-81
sp|Q2RM79|PANB_MOOTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=panB PE=3 SV=1 68 334 1.0E-80
sp|A5FR68|PANB_DEHMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=panB PE=3 SV=1 70 348 2.0E-80
sp|A0PXQ3|PANB_CLONN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=panB PE=3 SV=1 70 342 7.0E-80
sp|Q833S5|PANB_ENTFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=panB PE=3 SV=1 70 336 2.0E-79
sp|A6TMH9|PANB_ALKMQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=panB PE=3 SV=1 70 349 5.0E-79
sp|B2V1L8|PANB_CLOBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=panB PE=3 SV=1 70 341 8.0E-79
sp|C0QFH9|PANB_DESAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=panB PE=3 SV=1 70 334 7.0E-78
sp|B9LII0|PANB_CHLSY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=panB PE=3 SV=1 70 343 1.0E-77
sp|A9WFR7|PANB_CHLAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=panB PE=3 SV=1 70 343 1.0E-77
sp|Q0SHJ0|PANB_RHOJR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodococcus jostii (strain RHA1) GN=panB PE=3 SV=1 61 334 3.0E-77
sp|A8A9H3|PANB_IGNH4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=panB PE=3 SV=1 70 334 4.0E-77
sp|A6LWN6|PANB_CLOB8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=panB PE=3 SV=1 70 341 8.0E-77
sp|Q0RFD5|PANB_FRAAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Frankia alni (strain ACN14a) GN=panB PE=3 SV=2 61 334 2.0E-76
sp|A7HGZ2|PANB_ANADF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=panB PE=3 SV=1 65 334 7.0E-76
sp|Q1B6P5|PANB_MYCSS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain MCS) GN=panB PE=3 SV=1 63 334 2.0E-75
sp|A1UID0|PANB_MYCSK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain KMS) GN=panB PE=3 SV=1 63 334 2.0E-75
sp|A3Q1U4|PANB_MYCSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain JLS) GN=panB PE=3 SV=1 63 334 2.0E-75
sp|A1AUV8|PANB_PELPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=panB PE=3 SV=1 65 334 2.0E-75
sp|Q1IHA5|PANB_KORVE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=panB PE=3 SV=1 68 338 2.0E-75
sp|Q18C32|PANB_PEPD6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Peptoclostridium difficile (strain 630) GN=panB PE=3 SV=1 70 342 3.0E-75
sp|B8G644|PANB_CHLAD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=panB PE=3 SV=1 70 343 5.0E-75
sp|O58665|PANB_PYRHO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=panB PE=3 SV=1 84 350 5.0E-75
sp|Q8U1R2|PANB_PYRFU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=panB PE=3 SV=1 77 348 6.0E-75
sp|Q5JCY6|PANB_THEKO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=panB PE=3 SV=1 77 342 8.0E-75
sp|A3DDV7|PANB_CLOTH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=panB PE=3 SV=1 70 351 1.0E-74
sp|B7HHU3|PANB_BACC4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain B4264) GN=panB PE=3 SV=1 79 340 3.0E-74
sp|Q81FN7|PANB_BACCR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=panB PE=3 SV=1 79 340 3.0E-74
sp|A5N5W0|PANB_CLOK5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=panB PE=3 SV=1 70 342 6.0E-74
sp|Q0B0P6|PANB_SYNWW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=panB PE=3 SV=1 70 342 6.0E-74
sp|B7IPB7|PANB_BACC2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain G9842) GN=panB PE=3 SV=1 79 340 1.0E-73
sp|Q6HL16|PANB_BACHK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|Q63DJ3|PANB_BACCZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|C1EN36|PANB_BACC3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain 03BB102) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|B7JHQ6|PANB_BACC0 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain AH820) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|Q81ST3|PANB_BACAN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis GN=panB PE=3 SV=1 79 340 2.0E-73
sp|A0RBZ2|PANB_BACAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|C3L8Q0|PANB_BACAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|C3P5Q9|PANB_BACAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis (strain A0248) GN=panB PE=3 SV=1 79 340 2.0E-73
sp|B1GZJ8|PANB_UNCTG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=panB PE=3 SV=1 70 335 3.0E-73
sp|B8J7G7|PANB_ANAD2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=panB PE=3 SV=1 60 334 4.0E-73
sp|A0M360|PANB_GRAFK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gramella forsetii (strain KT0803) GN=panB PE=3 SV=2 66 334 6.0E-73
sp|B4UDZ3|PANB_ANASK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain K) GN=panB PE=3 SV=1 60 334 7.0E-73
sp|B7HL53|PANB_BACC7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain AH187) GN=panB PE=3 SV=1 79 340 8.0E-73
sp|A0L3M6|PANB_MAGMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=panB PE=3 SV=1 68 334 8.0E-73
sp|Q9V0E1|PANB_PYRAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=panB PE=3 SV=1 77 348 1.0E-72
sp|Q3J5N1|PANB_RHOS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=panB PE=3 SV=1 79 334 2.0E-72
sp|A3PGQ2|PANB_RHOS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=panB PE=3 SV=1 79 334 2.0E-72
sp|Q73AV4|PANB_BACC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=panB PE=3 SV=1 79 340 2.0E-72
sp|B3E5K9|PANB_GEOLS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=panB PE=3 SV=1 68 334 2.0E-72
sp|C5D3B3|PANB_GEOSW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus sp. (strain WCH70) GN=panB PE=3 SV=1 79 344 2.0E-72
sp|A9VME9|PANB_BACWK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=panB PE=3 SV=1 79 340 3.0E-72
sp|Q7NMK3|PANB_GLOVI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=panB PE=3 SV=2 71 323 4.0E-72
sp|A2SDV6|PANB1_METPP 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Methylibium petroleiphilum (strain PM1) GN=panB1 PE=3 SV=1 62 349 4.0E-72
sp|Q97F39|PANB_CLOAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=panB PE=3 SV=1 70 342 5.0E-72
sp|A7GAI6|PANB_CLOBL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=panB PE=3 SV=1 72 336 6.0E-72
sp|B1IEL6|PANB_CLOBK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=panB PE=3 SV=1 72 336 6.0E-72
sp|C1FS97|PANB_CLOBJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=panB PE=3 SV=1 72 336 6.0E-72
sp|A7FR60|PANB_CLOB1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=panB PE=3 SV=1 72 336 8.0E-72
sp|B0BYP7|PANB_ACAM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=panB PE=3 SV=1 71 328 1.0E-71
sp|A7GN76|PANB_BACCN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=panB PE=3 SV=1 79 344 1.0E-71
sp|Q9PIK1|PANB_CAMJE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=panB PE=3 SV=1 82 341 1.0E-71
sp|A8FK87|PANB_CAMJ8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=panB PE=3 SV=1 82 341 1.0E-71
sp|B1KUY7|PANB_CLOBM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=panB PE=3 SV=1 72 336 1.0E-71
sp|Q5HWH3|PANB_CAMJR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni (strain RM1221) GN=panB PE=3 SV=1 76 341 2.0E-71
sp|B2HHM7|PANB_MYCMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=panB PE=3 SV=1 47 334 2.0E-71
sp|Q2IFU2|PANB_ANADE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=panB PE=3 SV=1 54 334 3.0E-71
sp|Q9L7B2|PANB_MYCVP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=panB PE=3 SV=1 66 334 3.0E-71
sp|A4WVH0|PANB_RHOS5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=panB PE=3 SV=1 79 335 4.0E-71
sp|Q5YZ95|PANB_NOCFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=panB PE=3 SV=1 62 334 4.0E-71
sp|C3L035|PANB_CLOB6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=panB PE=3 SV=1 72 336 4.0E-71
sp|A0PNG6|PANB_MYCUA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=panB PE=3 SV=1 65 334 5.0E-71
sp|Q29W37|PANB_CAMJJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=panB PE=3 SV=1 82 341 6.0E-71
sp|A5FAQ5|PANB_FLAJ1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=panB PE=3 SV=1 66 334 1.0E-70
sp|B1XQ35|PANB_SYNP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=panB PE=3 SV=1 70 328 1.0E-70
sp|A7H574|PANB_CAMJD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=panB PE=3 SV=1 76 335 2.0E-70
sp|Q1DAN9|PANB_MYXXD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=panB PE=3 SV=1 68 338 3.0E-70
sp|Q74CG8|PANB_GEOSL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=panB PE=3 SV=1 72 334 7.0E-70
sp|Q47R98|PANB_THEFY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=panB PE=3 SV=1 54 334 8.0E-70
sp|B8HWP9|PANB_CYAP4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=panB PE=3 SV=1 71 330 8.0E-70
sp|Q39V51|PANB_GEOMG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=panB PE=3 SV=1 70 334 1.0E-69
sp|Q1GLQ6|PANB_RUEST 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruegeria sp. (strain TM1040) GN=panB PE=3 SV=1 85 334 2.0E-69
sp|A0RXQ5|PANB_CENSY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cenarchaeum symbiosum (strain A) GN=panB PE=3 SV=1 84 344 2.0E-69
sp|P9WIL7|PANB_MYCTU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=panB PE=1 SV=1 49 334 3.0E-69
sp|P9WIL6|PANB_MYCTO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=panB PE=3 SV=1 49 334 3.0E-69
sp|A1KKR8|PANB_MYCBP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=panB PE=3 SV=1 49 334 3.0E-69
sp|P0C2T4|PANB_MYCBO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=panB PE=3 SV=1 49 334 3.0E-69
sp|B1YBD4|PANB_PYRNV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=panB PE=3 SV=1 89 332 4.0E-69
sp|A1RU92|PANB_PYRIL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=panB PE=3 SV=1 85 332 5.0E-69
sp|Q3A3I6|PANB_PELCD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=panB PE=3 SV=1 72 334 6.0E-69
sp|Q9X251|PANB_THEMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=panB PE=3 SV=1 86 334 9.0E-69
sp|Q73YI6|PANB_MYCPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=panB PE=3 SV=1 54 334 1.0E-68
sp|B1LAU5|PANB_THESQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga sp. (strain RQ2) GN=panB PE=3 SV=1 86 334 1.0E-68
sp|A7IF97|PANB_XANP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=panB PE=3 SV=1 81 334 1.0E-68
sp|A8F498|PANB_PSELT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=panB PE=3 SV=1 71 334 1.0E-68
sp|Q6AJ44|PANB_DESPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=panB PE=3 SV=2 72 334 4.0E-68
sp|B8FFR9|PANB_DESAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=panB PE=3 SV=1 70 334 4.0E-68
sp|B6YS36|PANB_AZOPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=panB PE=3 SV=1 70 334 7.0E-68
sp|Q5WGA3|PANB_BACSK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=panB PE=3 SV=1 72 334 8.0E-68
sp|Q0ADS2|PANB_NITEC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosomonas eutropha (strain C91) GN=panB PE=3 SV=1 70 334 8.0E-68
sp|A4FA49|PANB_SACEN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=panB PE=3 SV=1 76 334 9.0E-68
sp|Q5KXX2|PANB_GEOKA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=panB PE=3 SV=1 79 344 9.0E-68
sp|Q215V6|PANB_RHOPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=panB PE=3 SV=1 81 336 1.0E-67
sp|B9K819|PANB_THENN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=panB PE=3 SV=1 86 334 2.0E-67
sp|Q07LA4|PANB_RHOP5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=panB PE=3 SV=1 79 338 2.0E-67
sp|Q65I56|PANB_BACLD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=panB PE=3 SV=1 79 338 2.0E-67
sp|Q1GR07|PANB_SPHAL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=panB PE=3 SV=1 52 334 2.0E-67
sp|Q4JA70|PANB_SULAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=panB PE=3 SV=1 69 332 3.0E-67
sp|A9A2T9|PANB_NITMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=panB PE=3 SV=1 72 348 4.0E-67
sp|Q8FUA5|PANB_COREF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=panB PE=3 SV=2 76 334 4.0E-67
sp|Q2JRY1|PANB_SYNJA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=panB PE=3 SV=1 71 330 6.0E-67
sp|A7Z5Z4|PANB_BACMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=panB PE=3 SV=1 79 338 1.0E-66
sp|A6LMK5|PANB_THEM4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=panB PE=3 SV=1 77 334 1.0E-66
sp|A4IQ61|PANB_GEOTN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=panB PE=3 SV=1 79 344 1.0E-66
sp|A4WMD4|PANB_PYRAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=panB PE=3 SV=1 81 332 1.0E-66
sp|C4L6Q0|PANB_EXISA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=panB PE=3 SV=1 72 344 1.0E-66
sp|B9M2A3|PANB_GEODF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=panB PE=3 SV=1 72 334 2.0E-66
sp|Q46XJ2|PANB_CUPPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=panB PE=3 SV=1 68 334 2.0E-66
sp|A8FEH7|PANB_BACP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=panB PE=3 SV=1 79 349 2.0E-66
sp|A1SIB6|PANB_NOCSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=panB PE=3 SV=1 67 334 2.0E-66
sp|Q6AFH4|PANB_LEIXX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=panB PE=3 SV=1 59 334 3.0E-66
sp|Q6G5H3|PANB_BARHE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=panB PE=3 SV=1 70 338 3.0E-66
sp|A4XMZ4|PANB_CALS8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=panB PE=3 SV=1 69 334 3.0E-66
sp|A2BMY4|PANB_HYPBU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=panB PE=3 SV=1 68 350 4.0E-66
sp|B6JGY0|PANB_OLICO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=panB PE=3 SV=1 81 339 5.0E-66
sp|B3Q9V6|PANB_RHOPT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=panB PE=3 SV=1 81 336 6.0E-66
sp|A0JVB5|PANB_ARTS2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arthrobacter sp. (strain FB24) GN=panB PE=3 SV=1 33 334 7.0E-66
sp|A9B2U4|PANB_HERA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=panB PE=3 SV=1 76 333 8.0E-66
sp|Q2JNI1|PANB_SYNJB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=panB PE=3 SV=1 71 328 1.0E-65
sp|Q1LJ86|PANB_CUPMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=panB PE=3 SV=1 68 334 1.0E-65
sp|Q1QMP7|PANB_NITHX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=panB PE=3 SV=1 81 339 2.0E-65
sp|Q9KC87|PANB_BACHD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=panB PE=3 SV=1 72 338 2.0E-65
sp|Q8DM44|PANB_THEEB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=panB PE=3 SV=2 68 328 2.0E-65
sp|A9H9N2|PANB_GLUDA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=panB PE=3 SV=1 70 341 2.0E-65
sp|P52996|PANB_BACSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus subtilis (strain 168) GN=panB PE=3 SV=1 84 344 2.0E-65
sp|Q0BSQ3|PANB_GRABC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=panB PE=3 SV=1 69 338 2.0E-65
sp|Q4JWH1|PANB_CORJK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium jeikeium (strain K411) GN=panB PE=3 SV=2 67 334 3.0E-65
sp|B9ML78|PANB_CALBD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=panB PE=3 SV=1 69 334 3.0E-65
sp|Q6N583|PANB_RHOPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=panB PE=3 SV=1 81 336 4.0E-65
sp|C3MU48|PANB_SULIM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=panB PE=3 SV=1 70 332 5.0E-65
sp|C4KKA3|PANB_SULIK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=panB PE=3 SV=1 70 332 5.0E-65
sp|C3N136|PANB_SULIA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=panB PE=3 SV=1 70 332 5.0E-65
sp|Q8ZT69|PANB_PYRAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=panB PE=3 SV=1 85 332 6.0E-65
sp|Q3B394|PANB_CHLL7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=panB PE=3 SV=1 60 334 7.0E-65
sp|Q64UB9|PANB_BACFR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=panB PE=3 SV=1 60 334 8.0E-65
sp|Q5LD96|PANB_BACFN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=panB PE=3 SV=1 60 334 8.0E-65
sp|C3MK79|PANB_SULIL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=panB PE=3 SV=1 70 332 8.0E-65
sp|Q82Y18|PANB_NITEU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=panB PE=3 SV=1 70 334 8.0E-65
sp|Q2IXB0|PANB_RHOP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=panB PE=3 SV=1 81 336 9.0E-65
sp|Q8XW45|PANB_RALSO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=panB PE=3 SV=1 68 334 9.0E-65
sp|Q89MZ4|PANB3_BRADU 3-methyl-2-oxobutanoate hydroxymethyltransferase 3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panB3 PE=3 SV=1 79 339 1.0E-64
sp|A1R5H8|PANB_ARTAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arthrobacter aurescens (strain TC1) GN=panB PE=3 SV=1 66 334 1.0E-64
sp|B7IDK8|PANB_THEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosipho africanus (strain TCF52B) GN=panB PE=3 SV=1 81 334 1.0E-64
sp|Q135K5|PANB_RHOPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=panB PE=3 SV=1 81 336 1.0E-64
sp|Q3SR08|PANB_NITWN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=panB PE=3 SV=1 81 339 1.0E-64
sp|Q9RR81|PANB_DEIRA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=panB PE=3 SV=2 79 344 1.0E-64
sp|B9JXS3|PANB_AGRVS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=panB PE=3 SV=1 60 334 1.0E-64
sp|Q7NXJ1|PANB_CHRVO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=panB PE=3 SV=1 70 334 1.0E-64
sp|A0QEV5|PANB_MYCA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium avium (strain 104) GN=panB PE=3 SV=1 68 334 1.0E-64
sp|C3N926|PANB_SULIY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=panB PE=3 SV=1 70 332 2.0E-64
sp|Q3M672|PANB_ANAVT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=panB PE=3 SV=1 71 328 2.0E-64
sp|Q72LM0|PANB_THET2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=panB PE=3 SV=2 82 334 2.0E-64
sp|Q5LWP5|PANB_RUEPO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=panB PE=3 SV=1 81 334 2.0E-64
sp|A5G3A0|PANB_GEOUR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=panB PE=3 SV=1 72 334 2.0E-64
sp|C3NMB9|PANB_SULIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=panB PE=3 SV=1 70 332 2.0E-64
sp|B1HU19|PANB_LYSSC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=panB PE=3 SV=1 83 342 2.0E-64
sp|A8MAX6|PANB_CALMQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=panB PE=3 SV=1 68 332 2.0E-64
sp|Q2VZ01|PANB_MAGSA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=panB PE=3 SV=1 81 338 3.0E-64
sp|B3EDF1|PANB_CHLL2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=panB PE=3 SV=1 60 334 3.0E-64
sp|Q9CBT0|PANB_MYCLE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium leprae (strain TN) GN=panB PE=3 SV=1 61 334 4.0E-64
sp|C5CFR2|PANB_KOSOT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=panB PE=3 SV=1 77 334 4.0E-64
sp|Q11Q55|PANB_CYTH3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=panB PE=3 SV=1 70 334 6.0E-64
sp|Q9RKS2|PANB_STRCO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=panB PE=3 SV=1 70 333 7.0E-64
sp|B5E846|PANB_GEOBB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=panB PE=3 SV=1 72 334 1.0E-63
sp|Q250S5|PANB_DESHY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=panB PE=3 SV=1 72 341 1.0E-63
sp|A3QHQ1|PANB_SHELP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=panB PE=3 SV=1 70 334 1.0E-63
sp|Q0BI15|PANB1_BURCM 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=panB1 PE=3 SV=1 68 334 1.0E-63
sp|Q5SL86|PANB_THET8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=panB PE=3 SV=1 82 334 1.0E-63
sp|B8G1S3|PANB_DESHD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=panB PE=3 SV=1 72 341 1.0E-63
sp|Q82AW2|PANB_STRAW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=panB PE=3 SV=1 70 333 1.0E-63
sp|Q5N1A6|PANB_SYNP6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=panB PE=3 SV=1 76 327 2.0E-63
sp|Q31KK8|PANB_SYNE7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=panB PE=3 SV=1 76 327 2.0E-63
sp|Q9YE97|PANB_AERPE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=panB PE=3 SV=1 67 333 2.0E-63
sp|B2JGD9|PANB_BURP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=panB PE=3 SV=1 68 334 3.0E-63
sp|Q4LA35|PANB_STAHJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=panB PE=3 SV=1 86 334 3.0E-63
sp|P65655|PANB_BRUSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|P65654|PANB_BRUME 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|C0RH46|PANB_BRUMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|A9M8B3|PANB_BRUC2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|Q57F29|PANB_BRUAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|Q2YPI1|PANB_BRUA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus (strain 2308) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|B2S9H9|PANB_BRUA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus (strain S19) GN=panB PE=3 SV=1 82 334 3.0E-63
sp|Q1BYX0|PANB_BURCA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=panB PE=3 SV=1 68 334 4.0E-63
sp|A0K4T1|PANB1_BURCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia cenocepacia (strain HI2424) GN=panB1 PE=3 SV=1 68 334 4.0E-63
sp|Q11F82|PANB_CHESB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chelativorans sp. (strain BNC1) GN=panB PE=3 SV=1 85 338 4.0E-63
sp|Q3JCP9|PANB_NITOC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=panB PE=3 SV=1 69 334 4.0E-63
sp|Q63R49|PANB_BURPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|A3ND64|PANB_BURP6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 668) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|Q3JP15|PANB_BURP1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=panB PE=1 SV=2 68 334 5.0E-63
sp|A3NYX3|PANB_BURP0 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|A1V0V0|PANB_BURMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain SAVP1) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|Q62HD8|PANB_BURMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=panB PE=3 SV=2 68 334 5.0E-63
sp|A2S561|PANB_BURM9 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|A3MN95|PANB_BURM7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=panB PE=3 SV=1 68 334 5.0E-63
sp|A1BH02|PANB_CHLPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=panB PE=3 SV=1 60 334 6.0E-63
sp|A9AGB5|PANB_BURM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=panB PE=3 SV=1 68 334 7.0E-63
sp|Q2SYZ1|PANB_BURTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=panB PE=1 SV=2 68 334 8.0E-63
sp|Q8YWS8|PANB_NOSS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=panB PE=3 SV=1 71 328 8.0E-63
sp|Q2S1H6|PANB_SALRD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=panB PE=3 SV=1 70 334 8.0E-63
sp|Q10WG3|PANB_TRIEI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=panB PE=3 SV=1 71 328 9.0E-63
sp|B3EQ18|PANB_CHLPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=panB PE=3 SV=1 71 334 1.0E-62
sp|B0CJW1|PANB_BRUSI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=panB PE=3 SV=1 82 334 1.0E-62
sp|Q0AQE4|PANB_MARMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Maricaulis maris (strain MCS10) GN=panB PE=3 SV=1 58 340 2.0E-62
sp|B9JH27|PANB_AGRRK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=panB PE=3 SV=1 85 334 2.0E-62
sp|Q9A7R9|PANB_CAUCR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=panB PE=3 SV=2 81 338 3.0E-62
sp|B8GVL8|PANB_CAUCN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=panB PE=3 SV=1 81 338 3.0E-62
sp|Q8KCS2|PANB_CHLTE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=panB PE=3 SV=1 60 334 3.0E-62
sp|B3QMS8|PANB_CHLP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=panB PE=3 SV=1 59 334 3.0E-62
sp|A3DPB2|PANB_STAMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=panB PE=3 SV=1 70 334 5.0E-62
sp|A4QAA6|PANB_CORGB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium glutamicum (strain R) GN=panB PE=3 SV=1 59 334 5.0E-62
sp|Q5NF58|PANB_FRATT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=panB PE=3 SV=1 84 334 6.0E-62
sp|Q14GL1|PANB_FRAT1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=panB PE=3 SV=1 84 334 6.0E-62
sp|A4IWW6|PANB_FRATW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=panB PE=3 SV=1 84 334 6.0E-62
sp|B2SFS9|PANB_FRATM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=panB PE=3 SV=1 84 334 6.0E-62
sp|A6L3Y2|PANB_BACV8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=panB PE=3 SV=1 70 334 6.0E-62
sp|Q39JC5|PANB2_BURL3 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=panB2 PE=3 SV=1 68 334 7.0E-62
sp|A6LA68|PANB_PARD8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=panB PE=3 SV=1 60 334 8.0E-62
sp|B2UBN8|PANB_RALPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ralstonia pickettii (strain 12J) GN=panB PE=3 SV=1 68 334 8.0E-62
sp|B7JVF9|PANB_CYAP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=panB PE=3 SV=1 81 328 1.0E-61
sp|A0Q7L2|PANB_FRATN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=panB PE=3 SV=1 84 334 1.0E-61
sp|Q0BMQ5|PANB_FRATO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=panB PE=3 SV=2 84 334 1.0E-61
sp|Q2A4C6|PANB_FRATH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=panB PE=3 SV=2 84 334 1.0E-61
sp|A7NB32|PANB_FRATF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=panB PE=3 SV=1 84 334 1.0E-61
sp|B4SAH9|PANB_PELPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=panB PE=3 SV=1 60 334 1.0E-61
sp|A9IRP2|PANB_BART1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=panB PE=3 SV=1 70 336 1.0E-61
sp|Q9AMS0|PANB2_BRADU 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panB2 PE=3 SV=2 60 348 1.0E-61
sp|B9DKF4|PANB_STACT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=panB PE=3 SV=1 73 334 2.0E-61
sp|Q5NL16|PANB2_ZYMMO 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=panB2 PE=3 SV=1 60 334 2.0E-61
sp|Q97W44|PANB_SULSO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=panB PE=3 SV=1 70 332 3.0E-61
sp|Q9X712|PANB_CORGL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=panB PE=1 SV=2 76 334 3.0E-61
sp|A0AK07|PANB_LISW6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=panB PE=3 SV=1 79 341 5.0E-61
sp|A4SE31|PANB_CHLPM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=panB PE=3 SV=1 60 334 5.0E-61
sp|Q145E8|PANB_BURXL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia xenovorans (strain LB400) GN=panB PE=3 SV=1 68 334 5.0E-61
sp|A4XYC4|PANB_PSEMY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas mendocina (strain ymp) GN=panB PE=3 SV=1 71 334 8.0E-61
sp|Q7MWM0|PANB_PORGI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=panB PE=3 SV=1 70 334 9.0E-61
sp|B2RIF8|PANB_PORG3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=panB PE=3 SV=1 70 334 9.0E-61
sp|Q16DW5|PANB_ROSDO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=panB PE=3 SV=1 81 334 1.0E-60
sp|Q8Y601|PANB_LISMO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=panB PE=3 SV=1 79 341 1.0E-60
sp|Q04XX5|PANB_LEPBL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=panB PE=3 SV=1 81 334 1.0E-60
sp|B2SXC3|PANB_BURPP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=panB PE=3 SV=1 68 334 2.0E-60
sp|Q8EIG9|PANB_SHEON 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=panB PE=3 SV=1 70 334 2.0E-60
sp|B4RAD7|PANB_PHEZH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=panB PE=3 SV=1 80 334 3.0E-60
sp|Q974Y0|PANB_SULTO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=panB PE=3 SV=1 70 332 3.0E-60
sp|A1B2L0|PANB_PARDP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=panB PE=3 SV=1 60 334 5.0E-60
sp|Q5X1M8|PANB_LEGPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Paris) GN=panB PE=3 SV=1 86 334 5.0E-60
sp|A8G084|PANB_SHESH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=panB PE=3 SV=1 70 334 5.0E-60
sp|Q2YAN9|PANB_NITMU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=panB PE=3 SV=1 70 334 5.0E-60
sp|Q71YB3|PANB_LISMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=panB PE=3 SV=1 79 341 6.0E-60
sp|C1KWK2|PANB_LISMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=panB PE=3 SV=1 79 341 6.0E-60
sp|A7HYW1|PANB_PARL1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=panB PE=3 SV=1 70 340 7.0E-60
sp|B8CTC6|PANB_SHEPW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=panB PE=3 SV=1 70 334 7.0E-60
sp|A4JBS4|PANB_BURVG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=panB PE=3 SV=1 68 334 8.0E-60
sp|A1S3M7|PANB_SHEAM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=panB PE=3 SV=2 70 334 9.0E-60
sp|Q5ZS58|PANB_LEGPH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=panB PE=3 SV=2 87 334 9.0E-60
sp|A0L0R2|PANB_SHESA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain ANA-3) GN=panB PE=3 SV=1 70 334 1.0E-59
sp|B1KEP6|PANB_SHEWM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=panB PE=3 SV=1 70 334 1.0E-59
sp|B6J9H8|PANB_COXB1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=panB PE=3 SV=1 76 334 1.0E-59
sp|Q0HRH6|PANB_SHESR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain MR-7) GN=panB PE=3 SV=1 70 334 1.0E-59
sp|Q83EA2|PANB_COXBU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=panB PE=3 SV=1 76 334 1.0E-59
sp|A9KEG7|PANB_COXBN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=panB PE=3 SV=2 76 334 1.0E-59
sp|Q5QVR5|PANB_IDILO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=panB PE=3 SV=1 70 334 1.0E-59
sp|Q2G6P1|PANB_NOVAD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=panB PE=3 SV=1 49 334 2.0E-59
sp|Q3SH83|PANB_THIDA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=panB PE=3 SV=1 71 334 2.0E-59
sp|B8DC24|PANB_LISMH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=panB PE=3 SV=1 79 341 2.0E-59
sp|A7NG79|PANB_ROSCS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=panB PE=3 SV=1 72 338 3.0E-59
sp|Q5WTD7|PANB_LEGPL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Lens) GN=panB PE=3 SV=1 87 334 3.0E-59
sp|A5URA8|PANB_ROSS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseiflexus sp. (strain RS-1) GN=panB PE=3 SV=1 70 341 3.0E-59
sp|Q0AB69|PANB_ALKEH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=panB PE=3 SV=1 61 334 3.0E-59
sp|A1RG67|PANB_SHESW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=panB PE=3 SV=1 70 334 3.0E-59
sp|A4YA61|PANB_SHEPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=panB PE=3 SV=1 70 334 3.0E-59
sp|A1KAA5|PANB_AZOSB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Azoarcus sp. (strain BH72) GN=panB PE=3 SV=1 71 334 3.0E-59
sp|Q92AA6|PANB_LISIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=panB PE=3 SV=1 79 341 4.0E-59
sp|Q0HMB1|PANB_SHESM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain MR-4) GN=panB PE=3 SV=1 70 334 4.0E-59
sp|A0LTD0|PANB_ACIC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=panB PE=3 SV=1 60 334 4.0E-59
sp|B6J1Q3|PANB_COXB2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=panB PE=3 SV=1 76 334 4.0E-59
sp|Q04VK1|PANB_LEPBJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=panB PE=3 SV=1 81 334 4.0E-59
sp|Q12JC6|PANB_SHEDO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=panB PE=3 SV=1 70 333 5.0E-59
sp|Q47B66|PANB_DECAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dechloromonas aromatica (strain RCB) GN=panB PE=3 SV=1 70 334 5.0E-59
sp|A8H0D4|PANB_SHEPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=panB PE=3 SV=1 70 334 5.0E-59
sp|Q07XZ8|PANB_SHEFN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=panB PE=3 SV=1 70 334 6.0E-59
sp|A5IAR5|PANB_LEGPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Corby) GN=panB PE=3 SV=1 86 334 7.0E-59
sp|Q6GDK4|PANB_STAAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=panB PE=3 SV=1 72 334 9.0E-59
sp|A6UB62|PANB_SINMW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=panB PE=3 SV=1 82 338 9.0E-59
sp|Q391N3|PANB1_BURL3 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=panB1 PE=3 SV=1 72 338 1.0E-58
sp|P65657|PANB_STAAW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MW2) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|A8Z3J9|PANB_STAAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|Q6G677|PANB_STAAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|P65656|PANB_STAAN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain N315) GN=panB PE=1 SV=1 72 334 1.0E-58
sp|A5IW24|PANB_STAA9 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain JH9) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|Q2FV21|PANB_STAA8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=panB PE=3 SV=2 72 334 1.0E-58
sp|Q2FDR0|PANB_STAA3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300) GN=panB PE=3 SV=2 72 334 1.0E-58
sp|A6U4X9|PANB_STAA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain JH1) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|Q5HCV3|PANB_STAAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain COL) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|Q931E6|PANB_STAAM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|A7X6X7|PANB_STAA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=panB PE=3 SV=1 72 334 1.0E-58
sp|Q92NN1|PANB_RHIME 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium meliloti (strain 1021) GN=panB PE=3 SV=1 82 338 1.0E-58
sp|C3MEL6|PANB_RHISN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium sp. (strain NGR234) GN=panB PE=3 SV=1 82 338 2.0E-58
sp|Q8CR20|PANB_STAES 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=panB PE=3 SV=1 72 335 2.0E-58
sp|Q5HL35|PANB_STAEQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=panB PE=3 SV=1 72 335 2.0E-58
sp|Q2YWF9|PANB_STAAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=panB PE=3 SV=1 72 334 2.0E-58
sp|Q1I4P2|PANB2_PSEE4 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas entomophila (strain L48) GN=panB2 PE=3 SV=1 70 334 2.0E-58
sp|Q8EZ98|PANB_LEPIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=panB PE=3 SV=1 81 334 2.0E-58
sp|Q72MN0|PANB_LEPIC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=panB PE=3 SV=1 81 334 2.0E-58
sp|B1YHQ9|PANB_EXIS2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=panB PE=3 SV=1 80 338 2.0E-58
sp|Q6NEB7|PANB_CORDI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=panB PE=3 SV=1 71 334 2.0E-58
sp|A9IHJ7|PANB_BORPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=panB PE=3 SV=1 86 334 3.0E-58
sp|Q6G078|PANB_BARQU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella quintana (strain Toulouse) GN=panB PE=3 SV=1 70 338 3.0E-58
sp|A6T221|PANB_JANMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=panB PE=3 SV=1 71 334 4.0E-58
sp|B0TTI2|PANB_SHEHH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=panB PE=3 SV=1 70 334 4.0E-58
sp|A0RN82|PANB_CAMFF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=panB PE=3 SV=1 70 334 4.0E-58
sp|A8EVP8|PANB_ARCB4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arcobacter butzleri (strain RM4018) GN=panB PE=3 SV=1 86 334 5.0E-58
sp|Q7VIU7|PANB_HELHP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=panB PE=3 SV=1 70 334 5.0E-58
sp|Q9I3C3|PANB1_PSEAE 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panB1 PE=3 SV=1 66 336 5.0E-58
sp|Q02K83|PANB1_PSEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=panB1 PE=3 SV=1 66 336 5.0E-58
sp|Q30PX5|PANB_SULDN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=panB PE=3 SV=1 85 334 5.0E-58
sp|Q2NAY0|PANB_ERYLH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=panB PE=3 SV=1 49 334 6.0E-58
sp|B1J2C2|PANB_PSEPW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain W619) GN=panB PE=3 SV=1 70 334 7.0E-58
sp|Q8ELF4|PANB_OCEIH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=panB PE=3 SV=1 79 334 7.0E-58
sp|Q0C444|PANB_HYPNA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=panB PE=3 SV=1 85 338 7.0E-58
sp|A6QK86|PANB_STAAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Newman) GN=panB PE=3 SV=1 72 334 7.0E-58
sp|A3MWA6|PANB_PYRCJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=panB PE=3 SV=1 86 335 9.0E-58
sp|Q3AS53|PANB_CHLCH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=panB PE=3 SV=1 71 334 1.0E-57
sp|Q1M4A0|PANB_RHIL3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=panB PE=3 SV=1 81 334 1.0E-57
sp|C1CX98|PANB_DEIDV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=panB PE=3 SV=1 85 344 1.0E-57
sp|B4RKE5|PANB_NEIG2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=panB PE=3 SV=1 71 334 1.0E-57
sp|Q5F9F9|PANB_NEIG1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=panB PE=3 SV=1 71 334 1.0E-57
sp|Q21F95|PANB_SACD2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=panB PE=3 SV=1 70 334 1.0E-57
sp|Q8UA91|PANB_AGRFC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=panB PE=3 SV=1 70 338 1.0E-57
sp|B4S8V9|PANB_PROA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=panB PE=3 SV=1 71 334 2.0E-57
sp|Q4A0U0|PANB_STAS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=panB PE=3 SV=1 72 334 2.0E-57
sp|Q9JUY0|PANB_NEIMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=panB PE=3 SV=1 71 334 3.0E-57
sp|Q2J886|PANB_FRASC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Frankia sp. (strain CcI3) GN=panB PE=3 SV=1 58 334 3.0E-57
sp|B1LTL1|PANB_METRJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=panB PE=3 SV=1 82 334 3.0E-57
sp|P38122|PANB_YEAST 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM31 PE=1 SV=1 72 350 3.0E-57
sp|Q6MHI3|PANB_BDEBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=panB PE=3 SV=1 82 335 3.0E-57
sp|Q2RP30|PANB_RHORT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=panB PE=3 SV=1 84 338 3.0E-57
sp|Q8A9W7|PANB_BACTN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=panB PE=3 SV=1 60 334 3.0E-57
sp|Q0K762|PANB_CUPNH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=panB PE=3 SV=2 68 334 4.0E-57
sp|Q9ZEP8|PANB_PSEFS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=panB PE=3 SV=1 71 334 4.0E-57
sp|B3R6G5|PANB_CUPTR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=panB PE=3 SV=1 68 334 4.0E-57
sp|B1ZHG6|PANB_METPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=panB PE=3 SV=1 82 335 4.0E-57
sp|Q1J1C0|PANB_DEIGD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=panB PE=3 SV=1 79 336 5.0E-57
sp|B6IX34|PANB_RHOCS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=panB PE=3 SV=1 81 339 7.0E-57
sp|A1KTB1|PANB_NEIMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=panB PE=3 SV=1 71 334 7.0E-57
sp|Q88DW9|PANB_PSEPK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain KT2440) GN=panB PE=3 SV=1 70 334 8.0E-57
sp|A5W974|PANB_PSEP1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=panB PE=3 SV=1 70 334 8.0E-57
sp|A9W3L5|PANB_METEP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium extorquens (strain PA1) GN=panB PE=3 SV=1 82 335 9.0E-57
sp|B7KWY8|PANB_METC4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=panB PE=3 SV=1 82 335 9.0E-57
sp|Q605H0|PANB_METCA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=panB PE=3 SV=1 71 334 1.0E-56
sp|Q9HPT6|PANB_HALSA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=panB PE=3 SV=1 75 334 1.0E-56
sp|B0R5P8|PANB_HALS3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=panB PE=3 SV=1 75 334 1.0E-56
sp|Q2JZU0|PANB_RHIEC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=panB PE=3 SV=1 81 334 2.0E-56
sp|A5CX20|PANB_VESOH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=panB PE=3 SV=1 71 334 2.0E-56
sp|Q3INP4|PANB_NATPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=panB PE=3 SV=1 81 334 2.0E-56
sp|O25698|PANB_HELPY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=panB PE=3 SV=1 67 334 2.0E-56
sp|Q47W60|PANB_COLP3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=panB PE=3 SV=1 70 334 3.0E-56
sp|Q17WP8|PANB_HELAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter acinonychis (strain Sheeba) GN=panB PE=3 SV=1 70 334 4.0E-56
sp|Q3K6Q6|PANB_PSEPF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=panB PE=3 SV=1 71 334 4.0E-56
sp|A1TYE6|PANB_MARHV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=panB PE=3 SV=1 71 334 4.0E-56
sp|B5ZAF6|PANB_HELPG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain G27) GN=panB PE=3 SV=1 67 334 5.0E-56
sp|Q4K5Y4|PANB2_PSEF5 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=panB2 PE=3 SV=1 71 334 6.0E-56
sp|Q1CUB6|PANB_HELPH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain HPAG1) GN=panB PE=3 SV=1 67 334 6.0E-56
sp|P52997|PANB_SYNY3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=panB PE=3 SV=1 81 328 1.0E-55
sp|Q5PBP6|PANB_ANAMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaplasma marginale (strain St. Maries) GN=panB PE=3 SV=1 81 334 1.0E-55
sp|Q7M878|PANB_WOLSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=panB PE=3 SV=1 70 334 1.0E-55
sp|B0STK1|PANB_LEPBP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=panB PE=3 SV=1 83 334 1.0E-55
sp|B0SAC5|PANB_LEPBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=panB PE=3 SV=1 83 334 1.0E-55
sp|A1AW70|PANB_RUTMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=panB PE=3 SV=1 71 334 1.0E-55
sp|B4RYN8|PANB_ALTMD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=panB1 PE=3 SV=1 70 334 1.0E-55
sp|B6JKW5|PANB_HELP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain P12) GN=panB PE=3 SV=1 67 334 1.0E-55
sp|Q9ZM56|PANB_HELPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=panB PE=3 SV=1 67 334 1.0E-55
sp|A7ZEL6|PANB_CAMC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter concisus (strain 13826) GN=panB PE=3 SV=1 68 335 1.0E-55
sp|B9KHN0|PANB_ANAMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaplasma marginale (strain Florida) GN=panB PE=3 SV=1 81 334 2.0E-55
sp|A7GZP8|PANB_CAMC5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter curvus (strain 525.92) GN=panB PE=3 SV=1 65 335 2.0E-55
sp|A1SSG9|PANB_PSYIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychromonas ingrahamii (strain 37) GN=panB PE=3 SV=1 70 334 3.0E-55
sp|Q12F40|PANB_POLSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=panB PE=3 SV=1 63 328 3.0E-55
sp|Q5NXQ3|PANB_AROAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=panB PE=3 SV=1 66 334 3.0E-55
sp|A6W2I3|PANB_MARMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Marinomonas sp. (strain MWYL1) GN=panB PE=3 SV=1 71 334 4.0E-55
sp|Q15NV5|PANB_PSEA6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=panB PE=3 SV=1 70 334 5.0E-55
sp|A0AXR0|PANB2_BURCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia cenocepacia (strain HI2424) GN=panB2 PE=3 SV=1 72 338 6.0E-55
sp|Q9JZW6|PANB_NEIMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=panB PE=1 SV=1 71 334 7.0E-55
sp|A1US40|PANB_BARBK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=panB PE=3 SV=1 81 336 8.0E-55
sp|C4L929|PANB_TOLAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=panB PE=3 SV=1 70 334 9.0E-55
sp|A4VPM6|PANB_PSEU5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=panB PE=3 SV=2 71 334 4.0E-54
sp|Q2SNS0|PANB1_HAHCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=panB1 PE=3 SV=1 68 338 4.0E-54
sp|A4SJ61|PANB_AERS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeromonas salmonicida (strain A449) GN=panB PE=3 SV=1 70 334 5.0E-54
sp|Q98NC9|PANB_RHILO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium loti (strain MAFF303099) GN=panB PE=3 SV=1 67 342 7.0E-54
sp|O67783|PANB_AQUAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aquifex aeolicus (strain VF5) GN=panB PE=3 SV=1 71 334 8.0E-54
sp|Q3ILK1|PANB_PSEHT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=panB PE=3 SV=1 70 334 9.0E-54
sp|B2USM4|PANB_HELPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain Shi470) GN=panB PE=3 SV=1 67 334 1.0E-53
sp|A1VKS3|PANB_POLNA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=panB PE=3 SV=2 48 328 2.0E-53
sp|A7MGP6|PANB_CROS8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=panB PE=3 SV=1 72 334 2.0E-53
sp|C3LS82|PANB_VIBCM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=panB PE=3 SV=1 70 333 2.0E-53
sp|Q9KUD0|PANB_VIBCH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=panB PE=3 SV=1 70 333 2.0E-53
sp|A5F975|PANB_VIBC3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=panB PE=3 SV=1 70 333 2.0E-53
sp|Q02FU3|PANB2_PSEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=panB2 PE=3 SV=1 71 334 2.0E-53
sp|B0UQT7|PANB_METS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium sp. (strain 4-46) GN=panB PE=3 SV=1 71 339 3.0E-53
sp|A4YED8|PANB_METS5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=panB PE=3 SV=1 79 332 3.0E-53
sp|A6Q1X8|PANB_NITSB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=panB PE=3 SV=1 72 334 3.0E-53
sp|Q2S8W3|PANB2_HAHCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Hahella chejuensis (strain KCTC 2396) GN=panB2 PE=3 SV=1 71 336 3.0E-53
sp|A0KP07|PANB_AERHH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=panB PE=3 SV=1 70 334 4.0E-53
sp|Q0B4Z6|PANB2_BURCM 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=panB2 PE=3 SV=1 72 338 4.0E-53
sp|Q9HV70|PANB2_PSEAE 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panB2 PE=3 SV=1 71 334 5.0E-53
sp|Q1H3S0|PANB_METFK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=panB PE=3 SV=1 75 334 5.0E-53
sp|A5GRJ3|PANB_SYNR3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain RCC307) GN=panB PE=3 SV=1 85 335 6.0E-53
sp|Q4ZY86|PANB_PSEU2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=panB PE=3 SV=1 70 334 7.0E-53
sp|Q21U09|PANB_RHOFT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=panB PE=3 SV=1 49 334 5.0E-52
sp|Q48N86|PANB_PSE14 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=panB PE=3 SV=1 70 334 8.0E-52
sp|Q7VV53|PANB_BORPE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=panB PE=3 SV=1 70 337 8.0E-52
sp|Q7W3E7|PANB_BORPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=panB PE=3 SV=1 70 337 8.0E-52
sp|Q7WER7|PANB_BORBR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=panB PE=3 SV=1 70 337 8.0E-52
sp|Q1I9K4|PANB1_PSEE4 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas entomophila (strain L48) GN=panB1 PE=3 SV=1 70 334 3.0E-51
sp|A1TTV9|PANB_ACIAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=panB PE=3 SV=1 38 328 3.0E-51
sp|B5FB05|PANB_VIBFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio fischeri (strain MJ11) GN=panB PE=3 SV=1 70 334 5.0E-51
sp|B5YZH1|PANB_ECO5E 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=panB PE=3 SV=1 72 334 6.0E-51
sp|Q8X929|PANB_ECO57 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O157:H7 GN=panB PE=3 SV=1 72 334 6.0E-51
sp|A9BV02|PANB_DELAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=panB PE=3 SV=1 63 328 6.0E-51
sp|Q5DZU8|PANB2_VIBF1 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=panB2 PE=3 SV=2 70 334 7.0E-51
sp|B7VK03|PANB_VIBTL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=panB PE=3 SV=1 70 333 7.0E-51
sp|A7MYX2|PANB_VIBCB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=panB PE=3 SV=1 70 333 7.0E-51
sp|Q6LMJ6|PANB_PHOPR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Photobacterium profundum GN=panB PE=3 SV=1 70 334 1.0E-50
sp|Q2NVR2|PANB_SODGM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sodalis glossinidius (strain morsitans) GN=panB PE=3 SV=1 72 334 2.0E-50
sp|Q8Z9D2|PANB_SALTI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella typhi GN=panB PE=3 SV=1 65 334 3.0E-50
sp|Q888Q5|PANB_PSESM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=panB PE=3 SV=1 70 334 3.0E-50
sp|A8ALE9|PANB_CITK8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=panB PE=3 SV=1 72 334 3.0E-50
sp|Q7UM39|PANB_RHOBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=panB PE=3 SV=1 65 334 3.0E-50
sp|A5WHD0|PANB_PSYWF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=panB PE=3 SV=1 71 334 4.0E-50
sp|Q7N869|PANB_PHOLL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=panB PE=3 SV=1 71 334 4.0E-50
sp|B6HZA9|PANB_ECOSE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli (strain SE11) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|A7ZW83|PANB_ECOHS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|B7LGJ6|PANB_ECO55 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|A7ZHM4|PANB_ECO24 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|A6T4T0|PANB_KLEP7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|B7LW41|PANB_ESCF3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=panB PE=3 SV=1 72 334 5.0E-50
sp|Q0VSR3|PANB_ALCBS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=panB PE=3 SV=1 71 334 6.0E-50
sp|Q8ZRR0|PANB_SALTY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B5BL65|PANB_SALPK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|Q5PIN3|PANB_SALPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B4SUA8|PANB_SALNS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella newport (strain SL254) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B4TK05|PANB_SALHS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella heidelberg (strain SL476) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B5RHC1|PANB_SALG2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B5R3E6|PANB_SALEP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|B5FIX8|PANB_SALDC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella dublin (strain CT_02021853) GN=panB PE=3 SV=1 72 334 6.0E-50
sp|Q32JW9|PANB_SHIDS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=panB PE=3 SV=1 72 334 9.0E-50
sp|Q87LV2|PANB_VIBPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=panB PE=3 SV=1 70 333 1.0E-49
sp|B6ELE1|PANB_ALISL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=panB PE=3 SV=1 70 334 1.0E-49
sp|Q5V3P6|PANB_HALMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=panB PE=3 SV=2 84 334 1.0E-49
sp|B7M175|PANB_ECO8A 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|Q6D1X6|PANB_PECAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|Q4FVG8|PANB_PSYA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|B5F833|PANB_SALA4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella agona (strain SL483) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|C0Q5P4|PANB_SALPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|Q57T73|PANB_SALCH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|A1WBI7|PANB_ACISJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidovorax sp. (strain JS42) GN=panB PE=3 SV=1 63 328 1.0E-49
sp|Q5E2T2|PANB1_VIBF1 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=panB1 PE=3 SV=1 70 334 1.0E-49
sp|A1WUU5|PANB_HALHL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=panB PE=3 SV=1 69 334 1.0E-49
sp|Q326A3|PANB_SHIBS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|B2U2Y1|PANB_SHIB3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|B8D8Z6|PANB_BUCA5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=panB PE=3 SV=1 71 334 1.0E-49
sp|B7N804|PANB_ECOLU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=panB PE=3 SV=1 72 334 1.0E-49
sp|Q83HM1|PANB_TROW8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=panB PE=3 SV=1 83 332 2.0E-49
sp|A4TPV5|PANB_YERPP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia pestis (strain Pestoides F) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q1CLW0|PANB_YERPN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|A9R1G2|PANB_YERPG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q8ZBK8|PANB_YERPE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia pestis GN=panB PE=3 SV=2 72 334 2.0E-49
sp|Q1C3V8|PANB_YERPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q1QEJ4|PANB_PSYCK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q83ME5|PANB_SHIFL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella flexneri GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q0T867|PANB_SHIF8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|Q83GK7|PANB_TROWT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tropheryma whipplei (strain Twist) GN=panB PE=3 SV=1 83 332 2.0E-49
sp|Q3Z5M6|PANB_SHISS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella sonnei (strain Ss046) GN=panB PE=3 SV=1 72 334 2.0E-49
sp|A1WDW4|PANB_VEREI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=panB PE=3 SV=2 61 328 2.0E-49
sp|B1Y4K8|PANB_LEPCP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=panB PE=3 SV=1 63 334 3.0E-49
sp|Q1QSZ9|PANB_CHRSD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=panB PE=3 SV=1 71 334 3.0E-49
sp|B7UII2|PANB_ECO27 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=panB PE=3 SV=1 72 334 4.0E-49
[Show less]

GO

GO Term Description Terminal node
GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity Yes
GO:0015940 pantothenate biosynthetic process Yes
GO:0043436 oxoacid metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0015939 pantothenate metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0016742 hydroxymethyl-, formyl- and related transferase activity No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0006766 vitamin metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup861
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5658
Ophiocordyceps australis map64 (Brazil) OphauB2|1309
Ophiocordyceps camponoti-floridani Ophcf2|01493
Ophiocordyceps camponoti-rufipedis Ophun1|3427 (this protein)
Ophiocordyceps kimflemingae Ophio5|3559
Ophiocordyceps subramaniannii Hirsu2|4833
Ophiocordyceps subramaniannii Hirsu2|5052

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3427
MALSRCPTRLLRQLAPGLRPVLSVPPAHRPRGAPIPTPTPTSAPAVGPSSQLRFSSHSPMGAPPSKPRGKVTVGT
LRTLHRKGDPITVITAHDFPSALAADHAGMDVVLVGDSLAMVALGMEDTSEVLVEEMLLHCRSVARATKSAFTVG
DLPMGSYEIAPEQALSTAIRFVKEGRVQGIKLEGGKDMAPTIRKITTAGIPVLGHVGLTPQRQNALGGFRVQGKT
RDGALAVLEDALAVQAAGCFGVVLEAVPAEVASLITQKLSIPTIGIGAGAGCSGQVLVQTDMIGNFPPGRFLPKF
VKKYGDVWAETTRALEAYREEVKTRQYPATEHTYPMPKAEFDAFAQTIKDL*
Coding >Ophun1|3427
ATGGCCCTCTCCCGCTGTCCCACTCGTTTGTTGAGGCAGCTCGCCCCGGGGCTGCGTCCGGTCCTCTCCGTCCCG
CCGGCCCACCGACCCCGGGGAGCTCCGATCCCGACTCCGACCCCGACCTCAGCTCCGGCGGTCGGACCCAGCTCA
CAGCTCCGGTTCAGCTCTCATTCTCCCATGGGCGCCCCGCCCTCCAAACCCCGCGGCAAAGTCACCGTCGGCACC
CTGCGGACACTGCACCGGAAGGGTGATCCCATCACCGTCATAACCGCCCACGACTTCCCCAGCGCTCTGGCTGCC
GACCACGCTGGGATGGATGTCGTCCTCGTCGGCGACAGTCTGGCCATGGTTGCCCTGGGCATGGAGGACACCAGC
GAGGTCCTGGTCGAGGAGATGCTGCTGCATTGTCGTTCGGTTGCGCGAGCCACCAAGAGCGCCTTCACCGTTGGC
GACCTGCCCATGGGATCGTACGAGATTGCACCCGAGCAGGCCCTGAGCACCGCCATCCGCTTCGTCAAGGAGGGC
AGGGTGCAGGGCATCAAGCTCGAGGGTGGCAAGGACATGGCGCCCACCATCCGCAAGATCACCACGGCCGGCATC
CCCGTCTTGGGCCACGTCGGCCTGACGCCTCAACGGCAAAATGCCCTCGGCGGCTTCCGCGTCCAGGGCAAGACG
CGCGACGGCGCCCTGGCCGTTCTCGAGGACGCCTTGGCCGTCCAAGCAGCCGGCTGCTTCGGTGTCGTCCTCGAA
GCCGTCCCCGCCGAGGTGGCCTCCTTGATCACGCAGAAACTGTCGATTCCCACCATCGGCATCGGTGCCGGCGCC
GGCTGCTCTGGACAGGTGCTGGTCCAGACCGACATGATTGGCAACTTTCCACCGGGCCGCTTCCTCCCCAAGTTT
GTCAAGAAGTACGGCGACGTGTGGGCCGAGACGACCAGGGCCCTCGAGGCCTACCGTGAAGAGGTGAAGACGCGT
CAGTATCCGGCAACCGAACACACATATCCGATGCCCAAGGCAGAGTTTGATGCGTTTGCCCAGACGATCAAAGAC
CTGTAG
Transcript >Ophun1|3427
ATGGCCCTCTCCCGCTGTCCCACTCGTTTGTTGAGGCAGCTCGCCCCGGGGCTGCGTCCGGTCCTCTCCGTCCCG
CCGGCCCACCGACCCCGGGGAGCTCCGATCCCGACTCCGACCCCGACCTCAGCTCCGGCGGTCGGACCCAGCTCA
CAGCTCCGGTTCAGCTCTCATTCTCCCATGGGCGCCCCGCCCTCCAAACCCCGCGGCAAAGTCACCGTCGGCACC
CTGCGGACACTGCACCGGAAGGGTGATCCCATCACCGTCATAACCGCCCACGACTTCCCCAGCGCTCTGGCTGCC
GACCACGCTGGGATGGATGTCGTCCTCGTCGGCGACAGTCTGGCCATGGTTGCCCTGGGCATGGAGGACACCAGC
GAGGTCCTGGTCGAGGAGATGCTGCTGCATTGTCGTTCGGTTGCGCGAGCCACCAAGAGCGCCTTCACCGTTGGC
GACCTGCCCATGGGATCGTACGAGATTGCACCCGAGCAGGCCCTGAGCACCGCCATCCGCTTCGTCAAGGAGGGC
AGGGTGCAGGGCATCAAGCTCGAGGGTGGCAAGGACATGGCGCCCACCATCCGCAAGATCACCACGGCCGGCATC
CCCGTCTTGGGCCACGTCGGCCTGACGCCTCAACGGCAAAATGCCCTCGGCGGCTTCCGCGTCCAGGGCAAGACG
CGCGACGGCGCCCTGGCCGTTCTCGAGGACGCCTTGGCCGTCCAAGCAGCCGGCTGCTTCGGTGTCGTCCTCGAA
GCCGTCCCCGCCGAGGTGGCCTCCTTGATCACGCAGAAACTGTCGATTCCCACCATCGGCATCGGTGCCGGCGCC
GGCTGCTCTGGACAGGTGCTGGTCCAGACCGACATGATTGGCAACTTTCCACCGGGCCGCTTCCTCCCCAAGTTT
GTCAAGAAGTACGGCGACGTGTGGGCCGAGACGACCAGGGCCCTCGAGGCCTACCGTGAAGAGGTGAAGACGCGT
CAGTATCCGGCAACCGAACACACATATCCGATGCCCAAGGCAGAGTTTGATGCGTTTGCCCAGACGATCAAAGAC
CTGTAG
Gene >Ophun1|3427
ATGGCCCTCTCCCGCTGTCCCACTCGTTTGTTGAGGCAGCTCGCCCCGGGGCTGCGTCCGGTCCTCTCCGTCCCG
CCGGCCCACCGACCCCGGGGAGCTCCGATCCCGACTCCGACCCCGACCTCAGCTCCGGCGGTCGGACCCAGCTCA
CAGCTCCGGTTCAGCTCTCATTCTCCCATGGGCGCCCCGCCCTCCAAACCCCGCGGCAAAGTCACCGTCGGCACC
CTGCGGACACTGCACCGGAAGGGTGATCCCATCACCGTCATAACCGCCCACGACTTCCCCAGCGCTCTGGCTGCC
GACCACGCTGGGATGGATGTCGTCCTCGTCGGCGACAGTCTGGCCATGGTTGCCCTGGGCATGGAGGACACCAGC
GAGGTCCTGGTCGAGGAGATGCTGCTGCATTGTCGTTCGGTTGCGCGAGCCACCAAGAGCGCCTTCACCGTGAGT
GCCGCACCGACTGTAACCCCCTATCACGACGGCGAGACTGACAAATAGCCTCAGGTTGGCGACCTGCCCATGGGA
TCGTACGAGATTGCACCCGAGCAGGCCCTGAGCACCGCCATCCGCTTCGTCAAGGAGGGCAGGGTGCAGGGCATC
AAGCTCGAGGGTGGCAAGGACATGGCGCCCACCATCCGCAAGATCACCACGGCCGGCATCCCCGTCTTGGGCCAC
GTCGGCCTGACGCCTCAACGGCAAAATGCCCTCGGCGGCTTCCGCGTCCAGGGCAAGACGCGCGACGGCGCCCTG
GCCGTTCTCGAGGACGCCTTGGCCGTCCAAGCAGCCGGCTGCTTCGGTGTCGTCCTCGAAGCCGTCCCCGCCGAG
GTGGCCTCCTTGATCACGCAGAAACTGTCGATTCCCACCATCGGCATCGGTGCCGGCGCCGGCTGCTCTGGACAG
GTGCTGGTCCAGACCGACATGATTGGCAACTTTCCACCGGGCCGCTTCCTCCCCAAGTTTGTCAAGAAGTACGGC
GACGTGTGGGCCGAGACGACCAGGGCCCTCGAGGCCTACCGTGAAGAGGTGAAGACGCGTCAGTATCCGGCAACC
GAACACACATATCCGATGCCCAAGGCAGAGTTTGATGCGTTTGCCCAGACGATCAAAGACCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail