Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3426
Gene name
LocationContig_303:17152..17562
Strand+
Gene length (bp)410
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04110 APG12 Ubiquitin-like autophagy protein Apg12 6.6E-26 28 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51P78|ATG12_MAGO7 Ubiquitin-like protein ATG12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG12 PE=3 SV=1 1 115 3.0E-52
sp|Q7S083|ATG12_NEUCR Ubiquitin-like protein atg12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg12 PE=3 SV=1 1 115 3.0E-48
sp|Q2GSG9|ATG12_CHAGB Ubiquitin-like protein ATG12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG12 PE=3 SV=2 1 115 7.0E-44
sp|Q2UMW6|ATG12_ASPOR Ubiquitin-like protein ATG12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg12 PE=3 SV=1 1 115 1.0E-42
sp|A7EAE5|ATG12_SCLS1 Ubiquitin-like protein ATG12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg12 PE=3 SV=2 1 115 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51P78|ATG12_MAGO7 Ubiquitin-like protein ATG12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG12 PE=3 SV=1 1 115 3.0E-52
sp|Q7S083|ATG12_NEUCR Ubiquitin-like protein atg12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg12 PE=3 SV=1 1 115 3.0E-48
sp|Q2GSG9|ATG12_CHAGB Ubiquitin-like protein ATG12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG12 PE=3 SV=2 1 115 7.0E-44
sp|Q2UMW6|ATG12_ASPOR Ubiquitin-like protein ATG12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg12 PE=3 SV=1 1 115 1.0E-42
sp|A7EAE5|ATG12_SCLS1 Ubiquitin-like protein ATG12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg12 PE=3 SV=2 1 115 2.0E-42
sp|A4D9P4|ATG12_ASPFU Ubiquitin-like protein ATG12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg12 PE=3 SV=1 1 115 2.0E-41
sp|A1DMW6|ATG12_NEOFI Ubiquitin-like protein ATG12 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg12 PE=3 SV=2 1 115 2.0E-41
sp|A1CTJ1|ATG12_ASPCL Ubiquitin-like protein ATG12 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg12 PE=3 SV=2 1 115 4.0E-41
sp|A7KAM3|ATG12_PENRW Ubiquitin-like protein ATG12 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg12 PE=3 SV=1 1 115 5.0E-41
sp|Q5BCH0|ATG12_EMENI Ubiquitin-like protein ATG12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg12 PE=3 SV=2 1 115 7.0E-41
sp|A6RA46|ATG12_AJECN Ubiquitin-like protein ATG12 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG12 PE=3 SV=1 1 115 1.0E-40
sp|Q1E8C2|ATG12_COCIM Ubiquitin-like protein ATG12 OS=Coccidioides immitis (strain RS) GN=ATG12 PE=3 SV=1 1 115 7.0E-40
sp|Q0UNW1|ATG12_PHANO Ubiquitin-like protein ATG12 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG12 PE=3 SV=1 1 115 8.0E-33
sp|P0CM28|ATG12_CRYNJ Ubiquitin-like protein ATG12 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG12 PE=3 SV=1 25 115 4.0E-20
sp|P0CM29|ATG12_CRYNB Ubiquitin-like protein ATG12 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG12 PE=3 SV=1 25 115 4.0E-20
sp|Q86CR6|ATG12_DICDI Ubiquitin-like protein atg12 OS=Dictyostelium discoideum GN=atg12 PE=3 SV=1 25 115 3.0E-19
sp|Q9US24|ATG12_SCHPO Ubiquitin-like protein ATG12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg12 PE=3 SV=1 28 115 4.0E-18
sp|Q69NP0|ATG12_ORYSJ Ubiquitin-like protein ATG12 OS=Oryza sativa subsp. japonica GN=ATG12 PE=3 SV=2 26 115 3.0E-16
sp|A2YAG8|ATG12_ORYSI Ubiquitin-like protein ATG12 OS=Oryza sativa subsp. indica GN=ATG12 PE=3 SV=2 26 115 3.0E-16
sp|Q6CUD5|ATG12_KLULA Ubiquitin-like protein ATG12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG12 PE=3 SV=1 25 115 4.0E-16
sp|A7TJM4|ATG12_VANPO Ubiquitin-like protein ATG12 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG12 PE=3 SV=1 1 115 5.0E-16
sp|Q6BU30|ATG12_DEBHA Ubiquitin-like protein ATG12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG12 PE=3 SV=1 1 115 1.0E-15
sp|A5E1F1|ATG12_LODEL Ubiquitin-like protein ATG12 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG12 PE=3 SV=1 10 115 1.0E-15
sp|Q6BZZ1|ATG12_YARLI Ubiquitin-like protein ATG12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG12 PE=3 SV=1 1 115 2.0E-15
sp|P38316|ATG12_YEAST Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG12 PE=1 SV=1 27 115 2.0E-14
sp|A6ZLF7|ATG12_YEAS7 Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG12 PE=3 SV=1 27 115 2.0E-14
sp|Q9LVK3|AT12B_ARATH Ubiquitin-like protein ATG12B OS=Arabidopsis thaliana GN=ATG12B PE=1 SV=1 27 115 3.0E-14
sp|Q1SF86|ATG12_MEDTR Ubiquitin-like protein ATG12 OS=Medicago truncatula GN=ATG12 PE=3 SV=1 28 115 1.0E-13
sp|Q8S924|AT12A_ARATH Ubiquitin-like protein ATG12A OS=Arabidopsis thaliana GN=ATG12A PE=1 SV=1 28 115 2.0E-13
sp|Q6FMM7|ATG12_CANGA Ubiquitin-like protein ATG12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG12 PE=3 SV=1 25 115 2.0E-13
sp|Q5AKU4|ATG12_CANAL Ubiquitin-like protein ATG12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG12 PE=3 SV=1 7 115 5.0E-12
sp|Q2TBJ5|ATG12_RAT Ubiquitin-like protein ATG12 OS=Rattus norvegicus GN=Atg12 PE=2 SV=1 25 115 2.0E-11
sp|O94817|ATG12_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens GN=ATG12 PE=1 SV=1 25 115 5.0E-11
sp|Q9CQY1|ATG12_MOUSE Ubiquitin-like protein ATG12 OS=Mus musculus GN=Atg12 PE=1 SV=1 25 115 7.0E-11
sp|A5DK05|ATG12_PICGU Ubiquitin-like protein ATG12 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG12 PE=3 SV=2 28 115 1.0E-10
sp|A3GI31|ATG12_PICST Ubiquitin-like protein ATG12 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG12 PE=3 SV=3 3 115 1.0E-10
sp|Q5R7W1|ATG12_PONAB Ubiquitin-like protein ATG12 OS=Pongo abelii GN=ATG12 PE=2 SV=1 25 115 2.0E-10
sp|Q3T0W7|ATG12_BOVIN Ubiquitin-like protein ATG12 OS=Bos taurus GN=ATG12 PE=2 SV=1 25 115 4.0E-10
sp|A7KAJ7|ATG12_PICAN Ubiquitin-like protein ATG12 OS=Pichia angusta GN=ATG12 PE=3 SV=1 1 115 9.0E-10
sp|Q75EB4|ATG12_ASHGO Ubiquitin-like protein ATG12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG12 PE=3 SV=1 28 115 4.0E-09
sp|Q9VTU1|APG12_DROME Autophagy protein 12-like OS=Drosophila melanogaster GN=Atg12 PE=3 SV=3 28 115 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0000045 autophagosome assembly Yes
GO:0070925 organelle assembly No
GO:0007033 vacuole organization No
GO:1905037 autophagosome organization No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5333
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5657
Ophiocordyceps australis map64 (Brazil) OphauB2|1310
Ophiocordyceps camponoti-floridani Ophcf2|01492
Ophiocordyceps camponoti-rufipedis Ophun1|3426 (this protein)
Ophiocordyceps kimflemingae Ophio5|3558
Ophiocordyceps subramaniannii Hirsu2|5051

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3426
MSASVMLADLPRDATWALADAGAFAQEKVVVRFKPVGAAPALAQDLCKISAARRFEEVVRYLRRKLRCAETESVF
LYVNSAFAPSLDEVVGNLHRCFKNAHDQLVVAYSITPAFG*
Coding >Ophun1|3426
ATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCAGACGCGGGCGCCTTTGCG
CAGGAAAAGGTCGTGGTGCGGTTCAAGCCTGTGGGAGCGGCGCCGGCGCTGGCGCAGGACCTCTGCAAGATTTCG
GCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATTTGAGGAGGAAGCTGAGGTGTGCTGAGACGGAGAGCGTCTTT
CTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTGGGCAATTTGCATCGGTGCTTCAAGAATGCT
CACGATCAACTAGTCGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG
Transcript >Ophun1|3426
ATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCAGACGCGGGCGCCTTTGCG
CAGGAAAAGGTCGTGGTGCGGTTCAAGCCTGTGGGAGCGGCGCCGGCGCTGGCGCAGGACCTCTGCAAGATTTCG
GCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATTTGAGGAGGAAGCTGAGGTGTGCTGAGACGGAGAGCGTCTTT
CTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTGGGCAATTTGCATCGGTGCTTCAAGAATGCT
CACGATCAACTAGTCGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG
Gene >Ophun1|3426
ATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCAGACGCGGGCGCCTTTGCG
CAGGAAAAGGTCGTGGTGCGGTTCAAGCCTGTGGGAGCGGCGCCGGCGCTGGCGCAGGACCTCTGCAAGATTTCG
GCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATTTGAGGAGGAAGCTGAGGTGTGCTGAGACGGAGAGCGTCTTT
CTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTGGGCAATTTGCATCGGGTATTTCCCTCTGGA
TTTTGGGCCTTGTTGTTTGGTGATTGATTGCTGACTTTATGTTGCAGTGCTTCAAGAATGCTCACGATCAACTAG
TCGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail