Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3416
Gene name
LocationContig_302:8445..11297
Strand+
Gene length (bp)2852
Transcript length (bp)2760
Coding sequence length (bp)2760
Protein length (aa) 920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.9E-195 153 877

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 131 919 0.0E+00
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 102 919 2.0E-178
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 99 919 4.0E-155
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 112 903 2.0E-142
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 117 903 1.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 131 919 0.0E+00
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 102 919 2.0E-178
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 99 919 4.0E-155
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 112 903 2.0E-142
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 117 903 1.0E-139
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 131 892 4.0E-137
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 114 909 1.0E-136
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 117 903 6.0E-131
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 95 903 7.0E-131
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 116 903 9.0E-131
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 107 892 2.0E-125
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 124 903 2.0E-120
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 83 910 1.0E-95
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 132 512 3.0E-65
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 585 910 3.0E-50
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 286 303 17
2 310 332 22
3 352 374 22
4 386 408 22
5 423 445 22
6 604 623 19
7 627 649 22
8 662 684 22
9 710 732 22
10 779 798 19
11 821 843 22
12 864 886 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3416
MPHPPRKSPSFLLAAQGTGRNGYAYGSVASAGDGDGDDAHPLRNVHDSFRSRRSMSSRRSHISWQSSSRRSEDLD
GAALASGLESRFSLVEAPLLGEILDDDDAATHGRTSQSEDDQDEDDYDSHSYSSRDDSPPEAVRASVPPTDNTTL
SINTPRMWCLSVLFSILGSSTNLFFSLRYPSVAITPVIALLLVHPLGHLWDLLLKRPYDPEQEFVDGVRVPPSNP
PVNNNLRPKKLDSWRQWLAQGRWNEKEHTCVYVSSNVAFGFAFATDVIVEQTRFYQQEAPIAYQLLLTISTQILG
YGFAGMARRFLVRPSGMIWPGTLMSAAMFSTLHRQDNKPADGWTISRWNFFYIVWGASFAFYFLPGLLFPALSYF
NVMTWFAPRNVVVANLFGVSSGLGLFPITFDWAQITYVGSPLLVPFWAAMNVIGGLVIVMWITAPLLYYTNVLYT
SYMPMLSSAVFDNTGAVYNVTKILTPDFLFDREAYSHYSRVFLPVTYALSYGVQFAGLAALLTHTLCWHGPDIWR
TIRRSLAEARRRPDANDSVNATAYHPVNDDAPPSAASASFPSPAEDPSGMSDSASNADGLLSREDVHCRLMNRYR
DAPLTWYLVTFASMTAIGIYPVHLPWYGLLLALSIGAIFFIPNGIIMAITNQHSSIYLICQLICGVVFPGRPIAN
MVFVTYGYISSAQGIKFAADLKLGHYMKIPPRLMFIVQVVATLVSSLTQIGVLNWMFANVKGLCSADAVNGFTCP
IARVHFNGSILWGVVGPAEFFGRDAIYRALVWCFPLGFLLPIPLWLYARNRKGSPVRKVNLPVLLGAMSWIPPAT
GLNFSVWALVCYLFNYLLRRRANAWWAKYTMTLSAALDSGLAFGILVVFFAFVYPGWMAGFHWWGTEVYKQGCDW
EACALRTVPEGETFGPHTW*
Coding >Ophun1|3416
ATGCCCCATCCACCCCGCAAGTCGCCGTCCTTCCTCCTCGCCGCCCAAGGCACAGGCCGCAACGGCTATGCCTAC
GGCTCCGTTGCCTCGGCCGGAGACGGCGACGGCGATGACGCCCATCCGCTACGCAACGTCCACGATAGCTTCAGG
AGTCGACGGAGCATGAGCTCCAGACGATCCCACATCTCGTGGCAGTCGTCGTCACGCCGTTCCGAAGATCTCGAC
GGTGCTGCCCTGGCTTCAGGCCTCGAGAGTCGCTTCAGCCTGGTCGAGGCGCCTCTCCTCGGAGAGATACTCGAC
GACGACGACGCCGCCACCCACGGCCGCACTTCCCAGTCCGAAGACGACCAAGACGAAGACGACTACGACTCCCAC
TCATACTCTTCCCGCGATGACTCCCCCCCCGAAGCCGTCCGCGCCTCAGTCCCTCCAACCGACAACACAACCCTC
TCCATCAACACCCCCCGAATGTGGTGTCTCTCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTC
TCCCTACGATACCCAAGCGTCGCCATCACCCCCGTCATCGCCCTCCTCCTCGTCCACCCCCTCGGCCACCTATGG
GACCTCCTCCTCAAGCGACCCTACGACCCCGAACAAGAATTCGTCGACGGCGTCCGCGTCCCCCCTTCCAACCCC
CCCGTCAACAACAATCTCCGCCCCAAGAAGCTCGACTCCTGGCGGCAATGGCTCGCCCAGGGCCGATGGAACGAA
AAGGAGCACACCTGCGTCTACGTCAGCAGCAACGTCGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAA
CAAACCCGCTTCTACCAACAGGAAGCCCCCATCGCCTACCAACTCCTCCTGACCATATCGACGCAGATCCTCGGC
TACGGCTTCGCCGGCATGGCCCGCCGCTTCCTCGTCCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCA
GCCGCCATGTTCTCAACCCTCCACCGACAAGACAACAAGCCGGCCGACGGCTGGACCATCAGCCGCTGGAACTTC
TTCTACATCGTCTGGGGCGCCTCCTTCGCCTTCTACTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTC
AACGTCATGACCTGGTTCGCGCCCCGAAACGTCGTCGTCGCCAACCTCTTCGGCGTCTCATCCGGCCTCGGCCTC
TTCCCCATTACCTTTGACTGGGCCCAAATCACCTACGTCGGCTCCCCTCTACTGGTCCCCTTCTGGGCCGCCATG
AACGTCATCGGCGGCCTCGTCATCGTCATGTGGATCACAGCACCGCTGCTCTACTACACAAACGTCCTCTACACC
TCTTACATGCCCATGCTATCCTCCGCCGTCTTCGACAACACAGGCGCCGTCTACAACGTCACCAAGATCCTCACG
CCAGACTTCCTCTTCGACCGCGAAGCCTACTCCCACTACAGCCGCGTCTTCCTCCCCGTCACCTACGCCCTCAGC
TACGGCGTCCAGTTCGCCGGTCTCGCCGCCCTGCTAACCCACACGCTCTGCTGGCACGGCCCCGACATCTGGCGC
ACCATCCGCAGGAGCCTCGCCGAAGCCCGTCGCCGCCCCGACGCCAACGACAGCGTCAATGCCACCGCCTATCAC
CCCGTCAACGACGATGCTCCCCCCTCGGCAGCATCAGCCTCGTTCCCCTCCCCCGCTGAAGACCCCAGCGGCATG
TCCGACTCGGCCTCCAACGCCGACGGCCTCCTCAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGCTACCGC
GACGCACCCCTGACCTGGTACCTCGTAACCTTTGCCTCCATGACAGCCATAGGCATCTACCCAGTCCACCTCCCG
TGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGCCATCACC
AACCAACACAGCAGCATCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCGGCCGCCCCATCGCAAAT
ATGGTCTTCGTAACCTACGGATACATCTCCTCCGCCCAGGGCATCAAGTTCGCTGCAGACCTCAAGCTCGGCCAC
TACATGAAGATCCCCCCCCGACTCATGTTCATCGTCCAGGTCGTCGCCACCCTCGTCTCCTCCCTCACCCAGATA
GGCGTCCTCAACTGGATGTTCGCCAACGTAAAGGGCTTATGCTCCGCCGACGCCGTCAACGGCTTCACCTGCCCC
ATCGCACGCGTCCACTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGTCCCGCCGAGTTCTTCGGCCGAGACGCC
ATCTACCGCGCCCTCGTCTGGTGCTTCCCCCTAGGCTTCCTCCTCCCCATCCCCCTCTGGCTCTACGCCCGCAAC
CGCAAAGGCAGCCCCGTCCGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCTGGATCCCGCCAGCCACG
GGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACCTCCTCCGCCGCCGCGCCAACGCCTGG
TGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCCTTTGGCATCCTCGTCGTCTTCTTC
GCCTTTGTTTACCCGGGTTGGATGGCTGGCTTTCACTGGTGGGGGACTGAAGTCTACAAGCAGGGCTGCGACTGG
GAGGCCTGCGCCTTGAGGACTGTTCCTGAAGGCGAGACGTTTGGGCCGCATACTTGGTGA
Transcript >Ophun1|3416
ATGCCCCATCCACCCCGCAAGTCGCCGTCCTTCCTCCTCGCCGCCCAAGGCACAGGCCGCAACGGCTATGCCTAC
GGCTCCGTTGCCTCGGCCGGAGACGGCGACGGCGATGACGCCCATCCGCTACGCAACGTCCACGATAGCTTCAGG
AGTCGACGGAGCATGAGCTCCAGACGATCCCACATCTCGTGGCAGTCGTCGTCACGCCGTTCCGAAGATCTCGAC
GGTGCTGCCCTGGCTTCAGGCCTCGAGAGTCGCTTCAGCCTGGTCGAGGCGCCTCTCCTCGGAGAGATACTCGAC
GACGACGACGCCGCCACCCACGGCCGCACTTCCCAGTCCGAAGACGACCAAGACGAAGACGACTACGACTCCCAC
TCATACTCTTCCCGCGATGACTCCCCCCCCGAAGCCGTCCGCGCCTCAGTCCCTCCAACCGACAACACAACCCTC
TCCATCAACACCCCCCGAATGTGGTGTCTCTCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTC
TCCCTACGATACCCAAGCGTCGCCATCACCCCCGTCATCGCCCTCCTCCTCGTCCACCCCCTCGGCCACCTATGG
GACCTCCTCCTCAAGCGACCCTACGACCCCGAACAAGAATTCGTCGACGGCGTCCGCGTCCCCCCTTCCAACCCC
CCCGTCAACAACAATCTCCGCCCCAAGAAGCTCGACTCCTGGCGGCAATGGCTCGCCCAGGGCCGATGGAACGAA
AAGGAGCACACCTGCGTCTACGTCAGCAGCAACGTCGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAA
CAAACCCGCTTCTACCAACAGGAAGCCCCCATCGCCTACCAACTCCTCCTGACCATATCGACGCAGATCCTCGGC
TACGGCTTCGCCGGCATGGCCCGCCGCTTCCTCGTCCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCA
GCCGCCATGTTCTCAACCCTCCACCGACAAGACAACAAGCCGGCCGACGGCTGGACCATCAGCCGCTGGAACTTC
TTCTACATCGTCTGGGGCGCCTCCTTCGCCTTCTACTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTC
AACGTCATGACCTGGTTCGCGCCCCGAAACGTCGTCGTCGCCAACCTCTTCGGCGTCTCATCCGGCCTCGGCCTC
TTCCCCATTACCTTTGACTGGGCCCAAATCACCTACGTCGGCTCCCCTCTACTGGTCCCCTTCTGGGCCGCCATG
AACGTCATCGGCGGCCTCGTCATCGTCATGTGGATCACAGCACCGCTGCTCTACTACACAAACGTCCTCTACACC
TCTTACATGCCCATGCTATCCTCCGCCGTCTTCGACAACACAGGCGCCGTCTACAACGTCACCAAGATCCTCACG
CCAGACTTCCTCTTCGACCGCGAAGCCTACTCCCACTACAGCCGCGTCTTCCTCCCCGTCACCTACGCCCTCAGC
TACGGCGTCCAGTTCGCCGGTCTCGCCGCCCTGCTAACCCACACGCTCTGCTGGCACGGCCCCGACATCTGGCGC
ACCATCCGCAGGAGCCTCGCCGAAGCCCGTCGCCGCCCCGACGCCAACGACAGCGTCAATGCCACCGCCTATCAC
CCCGTCAACGACGATGCTCCCCCCTCGGCAGCATCAGCCTCGTTCCCCTCCCCCGCTGAAGACCCCAGCGGCATG
TCCGACTCGGCCTCCAACGCCGACGGCCTCCTCAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGCTACCGC
GACGCACCCCTGACCTGGTACCTCGTAACCTTTGCCTCCATGACAGCCATAGGCATCTACCCAGTCCACCTCCCG
TGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGCCATCACC
AACCAACACAGCAGCATCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCGGCCGCCCCATCGCAAAT
ATGGTCTTCGTAACCTACGGATACATCTCCTCCGCCCAGGGCATCAAGTTCGCTGCAGACCTCAAGCTCGGCCAC
TACATGAAGATCCCCCCCCGACTCATGTTCATCGTCCAGGTCGTCGCCACCCTCGTCTCCTCCCTCACCCAGATA
GGCGTCCTCAACTGGATGTTCGCCAACGTAAAGGGCTTATGCTCCGCCGACGCCGTCAACGGCTTCACCTGCCCC
ATCGCACGCGTCCACTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGTCCCGCCGAGTTCTTCGGCCGAGACGCC
ATCTACCGCGCCCTCGTCTGGTGCTTCCCCCTAGGCTTCCTCCTCCCCATCCCCCTCTGGCTCTACGCCCGCAAC
CGCAAAGGCAGCCCCGTCCGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCTGGATCCCGCCAGCCACG
GGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACCTCCTCCGCCGCCGCGCCAACGCCTGG
TGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCCTTTGGCATCCTCGTCGTCTTCTTC
GCCTTTGTTTACCCGGGTTGGATGGCTGGCTTTCACTGGTGGGGGACTGAAGTCTACAAGCAGGGCTGCGACTGG
GAGGCCTGCGCCTTGAGGACTGTTCCTGAAGGCGAGACGTTTGGGCCGCATACTTGGTGA
Gene >Ophun1|3416
ATGCCCCATCCACCCCGCAAGTCGCCGTCCTTCCTCCTCGCCGCCCAAGGCACAGGCCGCAACGGCTATGCCTAC
GGCTCCGTTGCCTCGGCCGGAGACGGCGACGGCGATGACGCCCATCCGCTACGCAACGTCCACGATAGCTTCAGG
AGTCGACGGAGCATGAGCTCCAGACGATCCCACATCTCGTGGCAGTCGTCGTCACGCCGTTCCGAAGATCTCGAC
GGTGCTGCCCTGGCTTCAGGCCTCGAGAGTCGCTTCAGCCTGGTCGAGGCGCCTCTCCTCGGAGAGATACTCGAC
GACGACGACGCCGCCACCCACGGCCGCACTTCCCAGTCCGAAGACGACCAAGACGAAGACGACTACGACTCCCAC
TCATACTCTTCCCGCGATGACTCCCCCCCCGAAGCCGTCCGCGCCTCAGTCCCTCCAACCGACAACACAACCCTC
TCCATCAACACCCCCCGAATGTGGTGTCTCTCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTC
TCCCTACGATACCCAAGCGTCGCCATCACCCCCGTCATCGCCCTCCTCCTCGTCCACCCCCTCGGCCACCTATGG
GACCTCCTCCTCAAGCGACCCTACGACCCCGAACAAGAATTCGTCGACGGCGTCCGCGTCCCCCCTTCCAACCCC
CCCGTCAACAACAATCTCCGCCCCAAGAAGCTCGACTCCTGGCGGCAATGGCTCGCCCAGGGCCGATGGAACGAA
AAGGAGCACACCTGCGTCTACGTCAGCAGCAACGTCGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAA
CAAACCCGCTTCTACCAACAGGAAGCCCCCATCGCCTACCAACTCCTCCTGACCATATCGACGCAGATCCTCGGC
TACGGCTTCGCCGGCATGGCCCGCCGCTTCCTCGTCCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCA
GCCGCCATGTTCTCAACCCTCCACCGACAAGACAACAAGCCGGCCGACGGCTGGACCATCAGCCGCTGGAACTTC
TTCTACATCGTCTGGGGCGCCTCCTTCGCCTTCTACTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTC
AACGTCATGACCTGGTTCGCGCCCCGAAACGTCGTCGTCGCCAACCTCTTCGGCGTCTCATCCGGCCTCGGCCTC
TTCCCCATTACCTTTGACTGGGCCCAAATCACCTACGTCGGCTCCCCTCTACTGGTCCCCTTCTGGGCCGCCATG
AACGTCATCGGCGGCCTCGTCATCGTCATGTGGATCACAGCACCGCTGCTCTACTACACAAACGTCCTCTACACC
TCTTACATGCCCATGCTATCCTCCGCCGTCTTCGACAACACAGGCGCCGTCTACAACGTCACCAAGATCCTCACG
CCAGACTTCCTCTTCGACCGCGAAGCCTACTCCCACTACAGCCGCGTCTTCCTCCCCGTCACCTACGCCCTCAGC
TACGGCGTCCAGTTCGCCGGTCTCGCCGCCCTGCTAACCCACACGCTCTGCTGGCACGGCCCCGACATCTGGCGC
ACCATCCGCAGGAGCCTCGCCGAAGCCCGTCGCCGCCCCGACGCCAACGACAGCGTCAATGCCACCGCCTATCAC
CCCGTCAACGACGATGCTCCCCCCTCGGCAGCATCAGCCTCGTTCCCCTCCCCCGCTGAAGACCCCAGCGGCATG
TCCGACTCGGCCTCCAACGCCGACGGCCTCCTCAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGCTACCGC
GACGCACCCCTGACCTGGTACCTCGTAACCTTTGCCTCCATGACAGCCATAGGCATGTTCGTCGTCGAATAGTAA
GTCCAACCCCTTTCCCCCTAAACCAACCAACCAACCAACCCATCTCGCTCACCACACCCCAACCCCCCCATAGCT
ACCCAGTCCACCTCCCGTGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCA
TCATCATGGCCATCACCAACCAACACAGCAGCATCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCG
GCCGCCCCATCGCAAATATGGTCTTCGTAACCTACGGATACATCTCCTCCGCCCAGGGCATCAAGTTCGCTGCAG
ACCTCAAGCTCGGCCACTACATGAAGATCCCCCCCCGACTCATGTTCATCGTCCAGGTCGTCGCCACCCTCGTCT
CCTCCCTCACCCAGATAGGCGTCCTCAACTGGATGTTCGCCAACGTAAAGGGCTTATGCTCCGCCGACGCCGTCA
ACGGCTTCACCTGCCCCATCGCACGCGTCCACTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGTCCCGCCGAGT
TCTTCGGCCGAGACGCCATCTACCGCGCCCTCGTCTGGTGCTTCCCCCTAGGCTTCCTCCTCCCCATCCCCCTCT
GGCTCTACGCCCGCAACCGCAAAGGCAGCCCCGTCCGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCT
GGATCCCGCCAGCCACGGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACCTCCTCCGCC
GCCGCGCCAACGCCTGGTGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCCTTTGGCA
TCCTCGTCGTCTTCTTCGCCTTTGTTTACCCGGGTTGGATGGCTGGCTTTCACTGGTGGGGGACTGAAGTCTACA
AGCAGGGCTGCGACTGGGAGGCCTGCGCCTTGAGGACTGTTCCTGAAGGCGAGACGTTTGGGCCGCATACTTGGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail