Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3415
Gene name
LocationContig_302:3127..7645
Strand-
Gene length (bp)4518
Transcript length (bp)3723
Coding sequence length (bp)3723
Protein length (aa) 1241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family 1.0E-28 9 220
PF08389 Xpo1 Exportin 1-like protein 2.3E-25 374 517
PF03810 IBN_N Importin-beta N-terminal domain 1.2E-05 302 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USZ2|YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC11G11.07 PE=3 SV=2 284 1228 0.0E+00
sp|Q99189|MTR10_YEAST mRNA transport regulator MTR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR10 PE=1 SV=1 282 1225 1.0E-131
sp|Q6P2B1|TNPO3_MOUSE Transportin-3 OS=Mus musculus GN=Tnpo3 PE=1 SV=1 299 1218 2.0E-66
sp|Q9Y5L0|TNPO3_HUMAN Transportin-3 OS=Homo sapiens GN=TNPO3 PE=1 SV=3 299 1218 6.0E-66
sp|O94829|IPO13_HUMAN Importin-13 OS=Homo sapiens GN=IPO13 PE=1 SV=3 296 1214 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USZ2|YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC11G11.07 PE=3 SV=2 284 1228 0.0E+00
sp|Q99189|MTR10_YEAST mRNA transport regulator MTR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR10 PE=1 SV=1 282 1225 1.0E-131
sp|Q6P2B1|TNPO3_MOUSE Transportin-3 OS=Mus musculus GN=Tnpo3 PE=1 SV=1 299 1218 2.0E-66
sp|Q9Y5L0|TNPO3_HUMAN Transportin-3 OS=Homo sapiens GN=TNPO3 PE=1 SV=3 299 1218 6.0E-66
sp|O94829|IPO13_HUMAN Importin-13 OS=Homo sapiens GN=IPO13 PE=1 SV=3 296 1214 1.0E-39
sp|A7YWD2|IPO13_BOVIN Importin-13 OS=Bos taurus GN=IPO13 PE=2 SV=1 296 1214 2.0E-39
sp|Q5R974|IPO13_PONAB Importin-13 OS=Pongo abelii GN=IPO13 PE=2 SV=1 296 1214 2.0E-39
sp|Q8K0C1|IPO13_MOUSE Importin-13 OS=Mus musculus GN=Ipo13 PE=1 SV=1 299 1214 3.0E-39
sp|Q9JM04|IPO13_RAT Importin-13 OS=Rattus norvegicus GN=Ipo13 PE=2 SV=1 296 1214 7.0E-37
sp|Q5ZIC8|IPO13_CHICK Importin-13 OS=Gallus gallus GN=IPO13 PE=2 SV=1 265 1214 7.0E-33
sp|P80405|MTHFS_RABIT 5-formyltetrahydrofolate cyclo-ligase OS=Oryctolagus cuniculus GN=MTHFS PE=1 SV=1 7 219 1.0E-21
sp|Q9XWE6|MTHFS_CAEEL Probable 5-formyltetrahydrofolate cyclo-ligase OS=Caenorhabditis elegans GN=Y106G6E.4 PE=3 SV=1 3 219 1.0E-20
sp|Q9D110|MTHFS_MOUSE 5-formyltetrahydrofolate cyclo-ligase OS=Mus musculus GN=Mthfs PE=2 SV=2 4 219 2.0E-19
sp|P49914|MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens GN=MTHFS PE=1 SV=2 3 219 4.0E-19
sp|Q9P7W2|FTHC_SCHPO Probable 5-formyltetrahydrofolate cyclo-ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.08c PE=3 SV=1 9 219 1.0E-18
sp|P40099|FTHC_YEAST 5-formyltetrahydrofolate cyclo-ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAU1 PE=1 SV=1 6 223 5.0E-18
sp|P54491|YQGN_BACSU Uncharacterized protein YqgN OS=Bacillus subtilis (strain 168) GN=yqgN PE=1 SV=1 9 188 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0019899 enzyme binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0005515 protein binding No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0051020 GTPase binding No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3415
MTASLVAAKQQLRAVVKRRLSAVTPESLACQSRNILDALLAFPPYRDAARISVFLSMPGAEVQTDAIVRHALGCG
KQVFIPYLHKPPPELVDAPPRVMDMVDLAGLDDYEGLAPDRWGIPSVDPSTIHRRRHVLAGPPELRSALDLMLLP
GVAFDLDGTGRVRRLGHGRGFYDFFLGRYLSGYPSLLLVGLALNEQVLDGSAEERVPVEAHDWKLDGLIVGSGEP
SLETSISSGSVTRLTTVSPLAAACAWPAPSTPSARRLAPEAPPTMAANGPQEVFATSDVLAAVMTMRSGELEIKT
KAHQYLERFQKSKESWAIIISILQSEADAEASLFAAITLRGKLTYDLSTQVPPSELAGLRGQILVLLKRFAVGPK
PIRVQLCVCLAILAIQMKDWADVLPSVVQALSGSPESHACILDFLRVLPEEVTEGRKITLSEEDLAARTQALLGD
NTQQVVHLLINYAQSSAPASRNPQLMECITSWLREVPVASIINSPLLEVIFDGVASDECSREASECLCMMLRETR
EVDESQEAVQALFPRVIALRPQIGKAVADEDTDRLKSLTKVFATSAESWVVGIARQPEQFRPLVDAVLECAARDA
ERDVIEHTFSFWYDLKQYLVLGRYIQGRLEMVDVYSKLVDILLKQLEYPRPESGNETDLFDGDHEQEEKFREFRH
HMGDTLKDACDVMGVTECLTKVLHAIKMWMQKYAGQASGSDVPHWQELEAPLFAMRALGRMVDQDEGVVLPQLMP
LLVQIPSHEKLRFATIMVLGRYTEWTAAHPEYLEPQFNYIVNSFESDSREIMRAAALAIKYFCSDCQNLLSGQVL
QLQTFYDQVLDKLPEQSKEEMTEGVAKVVAVQPVAETYRLLKLCCDPLVRRLMEKANSATDEDGKLAVADDIQLV
TIMVQNVMPIVNPGEPNPAVKYWQEVFPILCTVLDNFLDFSPICERICRCWRNMVISYRTAMTPLLADMANKLAG
CFSTSREGCFLWVTSAILREFSEEREHVSQQTTDNIYTFFEAQTTTFLRVMTELQPRDLPDVIDDFFRLLIDALL
YYPQKLVPSPLLGPVLEAAIYALTLEQRDPLSSTLHFLRDLLSYGGNNPASSEGLSEQTAASIRAVVRALLLRNG
ASLIKQVMAGMMITFPRDCFADGSGVLLEMLQLMPAETMEWVAQTIQLLPQGSVSPSEAQRLLGKIKERLQSGDA
GGVRNVRGLLQDFTNTYRRRNVAPRDGLGELEAARFQFSG*
Coding >Ophun1|3415
ATGACCGCGTCGCTGGTCGCTGCTAAGCAGCAGCTCAGGGCTGTGGTTAAGCGTCGGCTCTCCGCCGTGACGCCA
GAGTCGCTGGCGTGTCAGAGTCGTAACATCTTGGATGCCCTTCTGGCTTTTCCGCCTTATCGAGATGCCGCTCGC
ATCAGCGTCTTTCTCTCCATGCCTGGAGCTGAGGTGCAGACTGATGCCATCGTCCGTCACGCGCTGGGCTGCGGC
AAGCAAGTCTTCATCCCTTACCTACACAAGCCGCCTCCCGAGCTGGTCGACGCACCGCCCCGCGTCATGGACATG
GTTGATCTCGCCGGTCTCGACGACTACGAGGGCCTCGCGCCAGATCGATGGGGGATCCCCTCGGTAGATCCGAGC
ACCATCCACCGCCGTCGCCACGTCCTCGCTGGTCCGCCGGAGTTGCGGTCCGCGCTCGATCTCATGTTGCTGCCG
GGCGTGGCTTTTGATCTGGATGGTACGGGTCGCGTTCGAAGACTGGGGCATGGAAGGGGGTTCTACGATTTCTTT
CTTGGGCGTTATTTGTCTGGATACCCGTCGCTTTTGCTGGTTGGGCTGGCGCTCAACGAGCAGGTTCTTGATGGG
TCTGCGGAGGAGAGGGTTCCGGTCGAGGCGCATGATTGGAAGCTGGATGGCTTGATAGTTGGGAGCGGTGAGCCG
AGTCTTGAGACGTCCATCTCATCTGGGTCCGTCACCCGCCTCACGACAGTCTCCCCTCTCGCAGCCGCATGCGCC
TGGCCCGCGCCGTCGACCCCTTCTGCTCGGCGTCTTGCCCCCGAGGCACCGCCCACGATGGCTGCCAACGGCCCG
CAGGAGGTCTTTGCTACCTCGGACGTCTTGGCTGCTGTCATGACGATGAGGAGCGGCGAGCTGGAGATCAAGACC
AAGGCTCATCAGTATCTCGAGAGGTTCCAGAAATCTAAAGAGTCCTGGGCCATCATCATCAGCATCCTCCAGTCC
GAAGCCGATGCAGAGGCTTCCCTCTTCGCCGCCATCACCCTCCGTGGAAAGCTCACCTATGACCTCTCGACACAA
GTGCCGCCCAGCGAACTTGCAGGGCTTCGTGGCCAGATACTCGTGCTGCTAAAGCGTTTCGCCGTCGGTCCGAAG
CCCATCAGAGTCCAGCTTTGCGTCTGCCTGGCCATCTTGGCCATACAGATGAAGGACTGGGCCGACGTCCTCCCG
TCGGTTGTCCAGGCGCTCAGCGGCAGCCCTGAAAGCCATGCCTGCATACTGGATTTTCTGCGAGTGCTCCCTGAG
GAGGTGACCGAGGGTCGCAAAATCACCTTGAGTGAAGAAGACTTGGCAGCCAGAACGCAGGCTTTGCTAGGGGAT
AATACGCAACAGGTCGTCCACCTCCTCATCAACTACGCCCAGTCGTCGGCCCCCGCGTCACGAAACCCCCAGCTA
ATGGAATGCATCACGTCGTGGTTGAGAGAGGTGCCGGTTGCCAGCATCATCAACTCGCCGCTACTTGAGGTCATC
TTTGATGGCGTCGCCAGTGACGAGTGCAGTCGGGAGGCGTCCGAGTGTCTATGCATGATGCTGCGGGAAACGCGC
GAGGTCGACGAGAGCCAGGAAGCCGTCCAGGCGCTGTTCCCTCGAGTCATCGCTCTCAGGCCGCAGATTGGAAAG
GCGGTCGCGGACGAGGACACGGACAGGCTCAAATCGCTGACCAAGGTGTTTGCGACCTCGGCCGAGAGCTGGGTC
GTCGGCATAGCGCGGCAGCCCGAGCAGTTCCGGCCCCTCGTCGACGCCGTGCTCGAGTGCGCGGCGCGAGACGCA
GAGCGAGACGTCATCGAGCACACCTTTTCTTTCTGGTATGATCTGAAGCAGTACCTCGTCCTCGGTCGGTATATA
CAGGGCCGGCTCGAGATGGTCGACGTCTACTCGAAGCTCGTCGATATCCTGCTCAAGCAGCTCGAGTACCCGCGG
CCCGAGTCTGGCAACGAGACCGATCTCTTCGACGGAGACCACGAGCAGGAGGAAAAGTTTCGCGAGTTCCGCCAC
CACATGGGCGACACGCTCAAGGACGCCTGCGACGTCATGGGCGTCACCGAGTGCCTGACAAAGGTGCTCCACGCC
ATCAAGATGTGGATGCAAAAGTACGCCGGCCAGGCATCGGGCAGCGACGTGCCGCACTGGCAGGAGCTGGAGGCG
CCGCTGTTCGCCATGCGCGCCCTCGGCCGTATGGTGGACCAGGACGAGGGCGTGGTGCTGCCACAGCTGATGCCG
CTGCTGGTGCAGATCCCGAGCCACGAGAAGCTCCGGTTCGCGACCATCATGGTTCTCGGACGCTACACGGAGTGG
ACGGCGGCGCACCCGGAATACCTGGAGCCGCAGTTCAACTACATTGTCAACTCGTTCGAGTCGGACTCGCGCGAG
ATTATGCGGGCGGCGGCCTTGGCCATCAAGTACTTCTGCAGCGACTGCCAGAACCTCCTCAGCGGTCAGGTGCTG
CAGCTGCAGACGTTTTACGATCAGGTGCTCGATAAGCTGCCCGAGCAGAGCAAGGAGGAGATGACCGAGGGAGTC
GCCAAGGTGGTTGCCGTGCAGCCGGTGGCCGAGACGTATCGCCTACTCAAGCTCTGCTGCGACCCTCTGGTGCGT
CGCCTGATGGAAAAGGCCAACAGCGCGACGGACGAAGATGGCAAGCTCGCGGTCGCAGATGATATCCAGCTCGTC
ACCATCATGGTGCAGAACGTGATGCCCATCGTCAACCCGGGCGAGCCGAACCCTGCCGTCAAGTACTGGCAGGAA
GTGTTTCCGATCCTGTGCACGGTTCTGGACAACTTCCTGGATTTCAGCCCTATCTGCGAGCGCATCTGTCGGTGC
TGGCGCAACATGGTCATCTCGTACCGGACGGCCATGACGCCGCTGCTGGCGGACATGGCCAACAAGCTGGCCGGC
TGCTTCAGCACCTCGCGAGAGGGCTGTTTCCTCTGGGTGACGTCGGCAATCCTCCGCGAGTTTTCGGAGGAGCGA
GAGCACGTCAGTCAGCAAACGACGGACAACATCTACACCTTCTTCGAGGCGCAGACGACGACGTTTCTGCGCGTC
ATGACGGAGCTGCAGCCGCGGGACCTGCCAGACGTCATCGACGACTTCTTCCGGCTGCTGATTGACGCGCTGCTG
TACTACCCGCAGAAGCTGGTGCCGTCGCCGCTGCTGGGGCCCGTCTTAGAGGCGGCCATCTACGCGCTGACGCTG
GAGCAACGGGACCCCCTCTCTTCGACGCTTCACTTTCTGCGGGATCTGTTGTCGTATGGCGGCAACAATCCGGCC
AGCAGTGAAGGATTGTCGGAGCAGACGGCGGCCAGCATCCGGGCCGTGGTGCGGGCGCTGCTGCTGAGGAACGGG
GCGAGCCTGATCAAGCAGGTGATGGCGGGCATGATGATAACGTTCCCGCGGGACTGCTTCGCCGACGGCAGCGGG
GTGCTGCTGGAGATGCTGCAGCTGATGCCGGCGGAGACGATGGAGTGGGTGGCGCAGACGATTCAGCTGCTGCCT
CAGGGGTCTGTGTCGCCGTCGGAGGCGCAGCGGCTGCTGGGCAAGATCAAGGAGAGACTGCAGTCCGGGGACGCG
GGGGGGGTCCGCAACGTTAGAGGCTTGTTGCAGGACTTTACCAACACGTACCGGCGCAGGAACGTGGCGCCTCGC
GATGGGCTGGGCGAGCTCGAGGCGGCGCGTTTTCAGTTTTCGGGCTGA
Transcript >Ophun1|3415
ATGACCGCGTCGCTGGTCGCTGCTAAGCAGCAGCTCAGGGCTGTGGTTAAGCGTCGGCTCTCCGCCGTGACGCCA
GAGTCGCTGGCGTGTCAGAGTCGTAACATCTTGGATGCCCTTCTGGCTTTTCCGCCTTATCGAGATGCCGCTCGC
ATCAGCGTCTTTCTCTCCATGCCTGGAGCTGAGGTGCAGACTGATGCCATCGTCCGTCACGCGCTGGGCTGCGGC
AAGCAAGTCTTCATCCCTTACCTACACAAGCCGCCTCCCGAGCTGGTCGACGCACCGCCCCGCGTCATGGACATG
GTTGATCTCGCCGGTCTCGACGACTACGAGGGCCTCGCGCCAGATCGATGGGGGATCCCCTCGGTAGATCCGAGC
ACCATCCACCGCCGTCGCCACGTCCTCGCTGGTCCGCCGGAGTTGCGGTCCGCGCTCGATCTCATGTTGCTGCCG
GGCGTGGCTTTTGATCTGGATGGTACGGGTCGCGTTCGAAGACTGGGGCATGGAAGGGGGTTCTACGATTTCTTT
CTTGGGCGTTATTTGTCTGGATACCCGTCGCTTTTGCTGGTTGGGCTGGCGCTCAACGAGCAGGTTCTTGATGGG
TCTGCGGAGGAGAGGGTTCCGGTCGAGGCGCATGATTGGAAGCTGGATGGCTTGATAGTTGGGAGCGGTGAGCCG
AGTCTTGAGACGTCCATCTCATCTGGGTCCGTCACCCGCCTCACGACAGTCTCCCCTCTCGCAGCCGCATGCGCC
TGGCCCGCGCCGTCGACCCCTTCTGCTCGGCGTCTTGCCCCCGAGGCACCGCCCACGATGGCTGCCAACGGCCCG
CAGGAGGTCTTTGCTACCTCGGACGTCTTGGCTGCTGTCATGACGATGAGGAGCGGCGAGCTGGAGATCAAGACC
AAGGCTCATCAGTATCTCGAGAGGTTCCAGAAATCTAAAGAGTCCTGGGCCATCATCATCAGCATCCTCCAGTCC
GAAGCCGATGCAGAGGCTTCCCTCTTCGCCGCCATCACCCTCCGTGGAAAGCTCACCTATGACCTCTCGACACAA
GTGCCGCCCAGCGAACTTGCAGGGCTTCGTGGCCAGATACTCGTGCTGCTAAAGCGTTTCGCCGTCGGTCCGAAG
CCCATCAGAGTCCAGCTTTGCGTCTGCCTGGCCATCTTGGCCATACAGATGAAGGACTGGGCCGACGTCCTCCCG
TCGGTTGTCCAGGCGCTCAGCGGCAGCCCTGAAAGCCATGCCTGCATACTGGATTTTCTGCGAGTGCTCCCTGAG
GAGGTGACCGAGGGTCGCAAAATCACCTTGAGTGAAGAAGACTTGGCAGCCAGAACGCAGGCTTTGCTAGGGGAT
AATACGCAACAGGTCGTCCACCTCCTCATCAACTACGCCCAGTCGTCGGCCCCCGCGTCACGAAACCCCCAGCTA
ATGGAATGCATCACGTCGTGGTTGAGAGAGGTGCCGGTTGCCAGCATCATCAACTCGCCGCTACTTGAGGTCATC
TTTGATGGCGTCGCCAGTGACGAGTGCAGTCGGGAGGCGTCCGAGTGTCTATGCATGATGCTGCGGGAAACGCGC
GAGGTCGACGAGAGCCAGGAAGCCGTCCAGGCGCTGTTCCCTCGAGTCATCGCTCTCAGGCCGCAGATTGGAAAG
GCGGTCGCGGACGAGGACACGGACAGGCTCAAATCGCTGACCAAGGTGTTTGCGACCTCGGCCGAGAGCTGGGTC
GTCGGCATAGCGCGGCAGCCCGAGCAGTTCCGGCCCCTCGTCGACGCCGTGCTCGAGTGCGCGGCGCGAGACGCA
GAGCGAGACGTCATCGAGCACACCTTTTCTTTCTGGTATGATCTGAAGCAGTACCTCGTCCTCGGTCGGTATATA
CAGGGCCGGCTCGAGATGGTCGACGTCTACTCGAAGCTCGTCGATATCCTGCTCAAGCAGCTCGAGTACCCGCGG
CCCGAGTCTGGCAACGAGACCGATCTCTTCGACGGAGACCACGAGCAGGAGGAAAAGTTTCGCGAGTTCCGCCAC
CACATGGGCGACACGCTCAAGGACGCCTGCGACGTCATGGGCGTCACCGAGTGCCTGACAAAGGTGCTCCACGCC
ATCAAGATGTGGATGCAAAAGTACGCCGGCCAGGCATCGGGCAGCGACGTGCCGCACTGGCAGGAGCTGGAGGCG
CCGCTGTTCGCCATGCGCGCCCTCGGCCGTATGGTGGACCAGGACGAGGGCGTGGTGCTGCCACAGCTGATGCCG
CTGCTGGTGCAGATCCCGAGCCACGAGAAGCTCCGGTTCGCGACCATCATGGTTCTCGGACGCTACACGGAGTGG
ACGGCGGCGCACCCGGAATACCTGGAGCCGCAGTTCAACTACATTGTCAACTCGTTCGAGTCGGACTCGCGCGAG
ATTATGCGGGCGGCGGCCTTGGCCATCAAGTACTTCTGCAGCGACTGCCAGAACCTCCTCAGCGGTCAGGTGCTG
CAGCTGCAGACGTTTTACGATCAGGTGCTCGATAAGCTGCCCGAGCAGAGCAAGGAGGAGATGACCGAGGGAGTC
GCCAAGGTGGTTGCCGTGCAGCCGGTGGCCGAGACGTATCGCCTACTCAAGCTCTGCTGCGACCCTCTGGTGCGT
CGCCTGATGGAAAAGGCCAACAGCGCGACGGACGAAGATGGCAAGCTCGCGGTCGCAGATGATATCCAGCTCGTC
ACCATCATGGTGCAGAACGTGATGCCCATCGTCAACCCGGGCGAGCCGAACCCTGCCGTCAAGTACTGGCAGGAA
GTGTTTCCGATCCTGTGCACGGTTCTGGACAACTTCCTGGATTTCAGCCCTATCTGCGAGCGCATCTGTCGGTGC
TGGCGCAACATGGTCATCTCGTACCGGACGGCCATGACGCCGCTGCTGGCGGACATGGCCAACAAGCTGGCCGGC
TGCTTCAGCACCTCGCGAGAGGGCTGTTTCCTCTGGGTGACGTCGGCAATCCTCCGCGAGTTTTCGGAGGAGCGA
GAGCACGTCAGTCAGCAAACGACGGACAACATCTACACCTTCTTCGAGGCGCAGACGACGACGTTTCTGCGCGTC
ATGACGGAGCTGCAGCCGCGGGACCTGCCAGACGTCATCGACGACTTCTTCCGGCTGCTGATTGACGCGCTGCTG
TACTACCCGCAGAAGCTGGTGCCGTCGCCGCTGCTGGGGCCCGTCTTAGAGGCGGCCATCTACGCGCTGACGCTG
GAGCAACGGGACCCCCTCTCTTCGACGCTTCACTTTCTGCGGGATCTGTTGTCGTATGGCGGCAACAATCCGGCC
AGCAGTGAAGGATTGTCGGAGCAGACGGCGGCCAGCATCCGGGCCGTGGTGCGGGCGCTGCTGCTGAGGAACGGG
GCGAGCCTGATCAAGCAGGTGATGGCGGGCATGATGATAACGTTCCCGCGGGACTGCTTCGCCGACGGCAGCGGG
GTGCTGCTGGAGATGCTGCAGCTGATGCCGGCGGAGACGATGGAGTGGGTGGCGCAGACGATTCAGCTGCTGCCT
CAGGGGTCTGTGTCGCCGTCGGAGGCGCAGCGGCTGCTGGGCAAGATCAAGGAGAGACTGCAGTCCGGGGACGCG
GGGGGGGTCCGCAACGTTAGAGGCTTGTTGCAGGACTTTACCAACACGTACCGGCGCAGGAACGTGGCGCCTCGC
GATGGGCTGGGCGAGCTCGAGGCGGCGCGTTTTCAGTTTTCGGGCTGA
Gene >Ophun1|3415
ATGACCGCGTCGCTGGTCGCTGCTAAGCAGCAGCTCAGGGCTGTGGTTAAGCGTCGGCTCTCCGCCGTGACGCCA
GAGTCGCTGGCGTGTCAGAGTGAGTATGGAAATGCTGGGTGATGGCGCGGGATGTCACTGATTTTCTTGTCGTCT
GGGCTAGGTCGTAACATCTTGGATGCCCTTCTGGCTTTTCCGCCTTATCGAGATGCCGCTCGCATCAGCGTCTTT
CTCTCCATGCCTGGAGCTGAGGTGCAGACTGATGCCATCGTCCGTCACGCGCTGGGCTGCGGCAAGCAAGTCTTC
ATCCCTTACCTACACAAGCCGCCTCCCGAGCTGGTCGACGCACCGCCCCGCGTCATGGACATGGTTGATCTCGCC
GGTCTCGACGACTACGAGGGCCTCGCGCCAGATCGATGGGGGATCCCCTCGGTAGATCCGAGCACCATCCACCGC
CGTCGCCACGTCCTCGCTGGTCCGCCGGAGTTGCGGTCCGCGCTCGATCTCATGTTGCTGCCGGGCGTGGCTTTT
GATCTGGATGGTACGGGTCGCGTTCGAAGACTGGGGCATGGAAGGGGGTTCTACGATTTCTTTCTTGGGCGTTAT
TTGTCTGGATACCCGTCGCTTTTGCTGGTTGGGCTGGCGCTCAACGAGCAGGTTCTTGATGGGTCTGCGGAGGAG
AGGGTTCCGGTCGAGGCGCATGATTGGAAGCTGGATGGCTTGATAGTTGGGAGCGGTGAGGTTCGAGTATCGGTT
GATGGTGATGGAGTGAAGTCGACATGTACTCACGAATAGACGTTTCATCTGAAAAGCGAGAGGAGACCATATAGT
GATTGTTTTCGACTCTTTCTCAGGCCCAAAGATCTTGCAGATATAACAACGAATACTTCTTCCATGAACTTATTC
TGGAATCCCTCGAGAAGCATCGTCACTCTCGATGCTCGTATTCGTACATCTGTTGTGCGACTATCGAAAACTGCC
GATTCCGAACGGAATAACAATATTCCATCTTTTAACTCTATGCCCCTCCAAAGAACGCGTTTCTCTATCAAACAG
CCTCATCACTTCATCGCGCATCGCTTCGACTCCATCACCGCCGGCTCCAAAGCTATCCCCGCAGCCGAGTCTTGA
GACGTCCATCTCATCTGGGTCCGTCACCCGCCTCACGACAGTCTCCCCTCTCGCAGCCGCATGCGCCTGGCCCGC
GCCGTCGACCCCTTCTGCTCGGCGTCTTGCCCCCGAGGCACCGCCCACGATGGCTGCCAACGGCCCGCAGGAGGT
CTTTGCTACCTCGGACGTCTTGGCTGCTGTCATGACGATGAGGAGCGGCGAGCTGGAGATCAAGACCAAGGCTCA
TCAGTATCTCGAGAGGTTCCAGAAATCTGTAGGCACTGATTCCGACTAGCTGCCTCCTGCCAGACTCTTGTTTCT
CACCACGTTTTCCTCTTGCAGAAAGAGTCCTGGGCCATCATCATCAGCATCCTCCAGTCCGAAGCCGATGCAGAG
GCTTCCCTCTTCGCCGCCATCACCCTCCGTGGAAAGGTTCTTCAGTCCGAAAATGGCCTTTCACGCCGCTTCGTC
GAGACTGACTGCCGCCCCAGCTCACCTATGACCTCTCGACACAAGTGCCGCCCAGCGAACTTGCAGGGCTTCGTG
GCCAGATACTCGTGCTGCTAAAGCGTTTCGCCGTCGGTCCGAAGCCCATCAGAGTCCAGCTTTGCGTCTGCCTGG
CCATCTTGGCCATACAGATGAAGGACTGGGCCGACGTCCTCCCGTCGGTTGTCCAGGCGCTCAGCGGCAGCCCTG
AAAGCCATGCCTGCATACTGGATTTTCTGCGAGTGCTCCCTGAGGAGGTGACCGAGGGTCGCAAAATCACCTTGA
GTGTACGTCGACCCAACAAGACCGACTTTGGACAGCACATCTTTTCCTGCGGCTACAATTATATCGGCCGTTGCG
GGTACCGTCAAGAGGCATGAGATTCTAATCAGCTGGTGGACACAGGAAGAAGACTTGGCAGCCAGAACGCAGGCT
TTGCTAGGGGATAATACGCAACAGGTCGTCCACCTCCTCATCAACTACGCCCAGTCGTCGGGTAACGTCACCCCC
GCCTGTCATAGAGACTCGCGCTGACGTCGAGATTCGCAGCCCCCGCGTCACGAAACCCCCAGCTAATGGAATGCA
TCACGTCGTGGTTGAGAGAGGTGCCGGTTGCCAGCATCATCAACTCGCCGCTACTTGAGGTCATCTTTGATGGCG
TCGCCAGTGACGAGTGCAGTCGGGAGGCGTCCGAGTGTCTATGCATGATGCTGCGGGAAACGCGCGAGGTCGACG
AGAGCCAGGAAGCCGTCCAGGCGCTGTTCCCTCGAGTCATCGCTCTCAGGCCGCAGATTGGAAAGGCGGTCGCGG
ACGAGGACACGGACAGGCTCAAATCGCTGACCAAGGTGTTTGCGACCTCGGCCGAGAGCTGGGTCGTCGGCATAG
CGCGGCAGCCCGAGCAGTTCCGGCCCCTCGTCGACGCCGTGCTCGAGTGCGCGGCGCGAGACGCAGAGCGAGACG
TCATCGAGCACACCTTTTCTTTCTGGTATGATCTGAAGCAGTACCTCGTCCTCGGTCGGTATATACAGGGCCGGC
TCGAGATGGTCGACGTCTACTCGAAGCTCGTCGATATCCTGCTCAAGCAGCTCGAGTACCCGCGGCCCGAGTCTG
GCAACGAGACCGATCTCTTCGACGGAGACCACGAGCAGGAGGAAAAGTTTCGCGAGTTCCGCCACCACATGGGCG
ACACGCTCAAGGACGCCTGCGACGTCATGGGCGTCACCGAGTGCCTGACAAAGGTGCTCCACGCCATCAAGATGT
GGATGCAAAAGTACGCCGGCCAGGCATCGGGCAGCGACGTGCCGCACTGGCAGGAGCTGGAGGCGCCGCTGTTCG
CCATGCGCGCCCTCGGCCGTATGGTGGACCAGGACGAGGGCGTGGTGCTGCCACAGCTGATGCCGCTGCTGGTGC
AGATCCCGAGCCACGAGAAGCTCCGGTTCGCGACCATCATGGTTCTCGGACGCTACACGGAGTGGACGGCGGCGC
ACCCGGAATACCTGGAGCCGCAGTTCAACTACATTGTCAACTCGTTCGAGTCGGACTCGCGCGAGATTATGCGGG
CGGCGGCCTTGGCCATCAAGTACTTCTGCAGCGACTGCCAGAACCTCCTCAGCGGTCAGGTGCTGCAGCTGCAGA
CGTTTTACGATCAGGTGCTCGATAAGCTGCCCGAGCAGAGCAAGGAGGAGATGACCGAGGGAGTCGCCAAGGTGG
TTGCCGTGCAGCCGGTGGCCGAGACGTATCGCCTACTCAAGCTCTGCTGCGACCCTCTGGTGCGTCGCCTGATGG
AAAAGGCCAACAGCGCGACGGACGAAGATGGCAAGCTCGCGGTCGCAGGTGAGGGGGCATATCTTGTCCGTGGAG
TGGTGAGAGCTGGCTGACAGTTGCATAGATGATATCCAGCTCGTCACCATCATGGTGCAGAACGTGATGCCCATC
GTCAACCCGGGCGAGCCGAACCCTGCCGTCAAGTACTGGCAGGAAGTGTTTCCGATCCTGTGCACGGTTCTGGAC
AACTTCCTGGATTTCAGCCCTATCTGCGAGCGCATCTGTCGGTGCTGGCGCAACATGGTCATCTCGTACCGGACG
GCCATGACGCCGCTGCTGGCGGACATGGCCAACAAGCTGGCCGGCTGCTTCAGCACCTCGCGAGAGGGCTGTTTC
CTCTGGGTGACGTCGGCAATCCTCCGCGAGTTTTCGGAGGAGCGAGAGCACGTCAGTCAGCAAACGACGGACAAC
ATCTACACCTTCTTCGAGGCGCAGACGACGACGTTTCTGCGCGTCATGACGGAGCTGCAGCCGCGGGACCTGCCA
GACGTCATCGACGACTTCTTCCGGCTGCTGATTGACGCGCTGCTGTACTACCCGCAGAAGCTGGTGCCGTCGCCG
CTGCTGGGGCCCGTCTTAGAGGCGGCCATCTACGCGCTGACGCTGGAGCAACGGGACCCCCTCTCTTCGACGCTT
CACTTTCTGCGGGATCTGTTGTCGTATGGCGGCAACAATCCGGCCAGCAGTGAAGGATTGTCGGAGCAGACGGCG
GCCAGCATCCGGGCCGTGGTGCGGGCGCTGCTGCTGAGGAACGGGGCGAGCCTGATCAAGCAGGTGATGGCGGGC
ATGATGATAACGTTCCCGCGGGACTGCTTCGCCGACGGCAGCGGGGTGCTGCTGGAGATGCTGCAGCTGATGCCG
GCGGAGACGATGGAGTGGGTGGCGCAGACGATTCAGCTGCTGCCTCAGGGGTCTGTGTCGCCGTCGGAGGCGCAG
CGGCTGCTGGGCAAGATCAAGGAGAGACTGCAGTCCGGGGACGCGGGGGGGGTCCGCAACGTTAGAGGCTTGTTG
CAGGACTTTACCAACACGTACCGGCGCAGGAACGTGGCGCCTCGCGATGGGCTGGGCGAGCTCGAGGCGGCGCGT
TTTCAGTTTTCGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail