Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3412
Gene name
LocationContig_301:13059..15118
Strand-
Gene length (bp)2059
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 1.1E-75 29 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 23 444 4.0E-68
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 25 447 4.0E-65
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 23 435 7.0E-62
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 23 435 7.0E-62
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 7 432 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 23 444 4.0E-68
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 25 447 4.0E-65
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 23 435 7.0E-62
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 23 435 7.0E-62
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 7 432 5.0E-60
sp|P9WIA9|PHLD_MYCTU Phospholipase C 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcD PE=3 SV=1 26 438 4.0E-52
sp|P9WIA8|PHLD_MYCTO Phospholipase C 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcD PE=3 SV=1 26 438 4.0E-52
sp|P0A5R9|PHLD_MYCBO Phospholipase C 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plcD PE=3 SV=1 26 438 4.0E-52
sp|P9WIB4|PHLA_MYCTO Phospholipase C 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcA PE=3 SV=1 26 476 2.0E-50
sp|P9WIB5|PHLA_MYCTU Phospholipase C 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcA PE=1 SV=1 26 476 2.0E-50
sp|P9WIB3|PHLB_MYCTU Phospholipase C 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcB PE=1 SV=1 26 476 2.0E-48
sp|P9WIB2|PHLB_MYCTO Phospholipase C 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcB PE=3 SV=1 26 476 2.0E-48
sp|Q8H965|NPC6_ARATH Non-specific phospholipase C6 OS=Arabidopsis thaliana GN=NPC6 PE=2 SV=1 7 388 2.0E-15
sp|O81020|NPC2_ARATH Non-specific phospholipase C2 OS=Arabidopsis thaliana GN=NPC2 PE=2 SV=1 3 385 7.0E-14
sp|Q9SRQ7|NPC4_ARATH Non-specific phospholipase C4 OS=Arabidopsis thaliana GN=NPC4 PE=1 SV=1 29 385 3.0E-13
sp|Q9SRQ6|NPC3_ARATH Non-specific phospholipase C3 OS=Arabidopsis thaliana GN=NPC3 PE=2 SV=1 29 446 5.0E-13
sp|Q9S816|NPC5_ARATH Non-specific phospholipase C5 OS=Arabidopsis thaliana GN=NPC5 PE=2 SV=1 29 385 6.0E-13
sp|Q8L7Y9|NPC1_ARATH Non-specific phospholipase C1 OS=Arabidopsis thaliana GN=NPC1 PE=2 SV=1 29 414 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999683

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup585
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2380
Ophiocordyceps australis map64 (Brazil) OphauB2|3830
Ophiocordyceps camponoti-floridani Ophcf2|03026
Ophiocordyceps camponoti-rufipedis Ophun1|3412 (this protein)
Ophiocordyceps kimflemingae Ophio5|4794
Ophiocordyceps subramaniannii Hirsu2|6220
Ophiocordyceps subramaniannii Hirsu2|7145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3412
MPITMALLGLYALFAHGIYAANTASLADIDHVVLFMQENRAFDHYLGTMAGVRGFKDANLQLNNGVTVWKQLTSP
KLTNDSGFVSPWYLNYLAGDWPAATQCMLAGSNGWFENHAAWNQGANNRWAVDNTPWSIGFYKRCDVPVQWALAD
GWIVADMYQESVVASTSPNRVTWISGSINVPGSPQRPDQGGNPYIDNNETPGCEKGGINCYPLKWKTAAELYQEA
GVSWQVYQDADNFDDNPFAWFKQFQDARKGSSLHSRGVKGLSLDVFYRQAANGTLPEISYIVGPTELSEHTPYSP
HDGAWLQRKIASAITSSPKYANTVLIISYDETGGWFDHVDPFRAPDGTPGEWLDDPYSQVGHTFSGPGFRVPMYI
ISPWTRRGGVYTEHADHNSQLLFIERWQSAKGRNVTTREMGPWRREKMGDLVAAFDFSRPDYSLPVLPEAPEPHK
DGRGVYDGSAHCMALFDATRPPVPYKGRGVIDDMASQVEKGFKSIRGRLTEGRFLVLEMESHALTASPEANKATL
TASTEQHDCPQQRWIAHAKERGGDEFTLSSAVDGRFLCGEAELCQLRG*
Coding >Ophun1|3412
ATGCCCATCACCATGGCTCTCCTTGGGCTCTACGCCCTCTTCGCCCATGGCATCTACGCCGCCAACACCGCCAGC
CTAGCAGACATCGACCACGTCGTCCTCTTCATGCAAGAGAACCGCGCCTTCGACCACTACCTAGGCACCATGGCC
GGCGTCCGCGGCTTCAAAGACGCCAACCTCCAGCTCAACAACGGCGTCACCGTGTGGAAGCAGCTGACGAGCCCC
AAACTGACAAACGACTCGGGCTTCGTCTCTCCTTGGTATCTCAACTATCTGGCGGGTGACTGGCCGGCTGCCACG
CAGTGTATGCTGGCGGGGAGCAACGGCTGGTTTGAGAATCACGCTGCGTGGAATCAGGGGGCTAATAACCGGTGG
GCTGTCGATAATACGCCTTGGAGCATTGGCTTCTATAAGCGGTGCGACGTTCCCGTGCAGTGGGCGCTTGCTGAC
GGCTGGATCGTCGCCGACATGTATCAAGAATCCGTCGTGGCATCCACCTCCCCCAACAGAGTAACCTGGATCAGC
GGCTCCATCAACGTACCCGGAAGCCCACAGAGGCCAGACCAAGGAGGGAACCCTTACATCGACAACAACGAGACG
CCCGGCTGTGAAAAGGGCGGCATCAACTGCTACCCGCTCAAGTGGAAGACGGCAGCTGAGCTTTACCAGGAAGCC
GGTGTGTCGTGGCAGGTGTATCAGGACGCTGACAACTTTGACGATAACCCGTTTGCCTGGTTCAAGCAGTTCCAG
GATGCGAGAAAGGGGTCGAGTTTACATAGTAGAGGAGTCAAGGGTCTTTCACTCGATGTCTTTTACCGGCAGGCT
GCCAACGGCACCCTCCCCGAGATATCCTACATCGTCGGTCCAACAGAGCTATCAGAACACACGCCCTACTCCCCC
CACGACGGCGCCTGGCTCCAACGCAAGATCGCCTCAGCCATCACCTCATCACCCAAATACGCAAACACCGTCCTC
ATAATCTCCTACGACGAAACAGGCGGCTGGTTCGACCACGTAGATCCCTTCCGCGCCCCCGACGGCACACCAGGC
GAATGGCTCGACGACCCTTACAGCCAAGTAGGCCATACCTTCTCCGGCCCAGGCTTCCGCGTGCCAATGTACATC
ATCTCCCCCTGGACGCGACGAGGCGGCGTCTACACCGAGCACGCCGATCATAACTCGCAGCTGCTCTTCATCGAG
CGCTGGCAGTCCGCCAAGGGACGCAACGTGACGACGCGGGAGATGGGGCCCTGGCGGAGGGAGAAGATGGGCGAT
CTCGTCGCTGCCTTTGACTTTTCCAGACCGGATTATAGCCTGCCTGTCTTACCGGAGGCGCCGGAACCGCATAAG
GATGGGAGGGGGGTTTATGATGGTTCGGCGCATTGTATGGCGCTCTTCGATGCTACGAGACCTCCTGTTCCGTAC
AAGGGGAGGGGTGTCATCGACGACATGGCCTCTCAGGTGGAAAAGGGCTTCAAATCTATCCGCGGACGCCTCACC
GAAGGCCGCTTCCTCGTCCTAGAGATGGAATCCCACGCACTGACAGCCTCTCCTGAAGCCAACAAGGCAACCCTC
ACAGCCAGCACAGAACAGCACGACTGCCCTCAGCAGCGATGGATTGCCCACGCCAAGGAGAGAGGCGGGGATGAG
TTTACGCTGAGCAGTGCCGTCGATGGCCGCTTTCTTTGCGGGGAGGCAGAGTTGTGTCAGTTACGAGGTTGA
Transcript >Ophun1|3412
ATGCCCATCACCATGGCTCTCCTTGGGCTCTACGCCCTCTTCGCCCATGGCATCTACGCCGCCAACACCGCCAGC
CTAGCAGACATCGACCACGTCGTCCTCTTCATGCAAGAGAACCGCGCCTTCGACCACTACCTAGGCACCATGGCC
GGCGTCCGCGGCTTCAAAGACGCCAACCTCCAGCTCAACAACGGCGTCACCGTGTGGAAGCAGCTGACGAGCCCC
AAACTGACAAACGACTCGGGCTTCGTCTCTCCTTGGTATCTCAACTATCTGGCGGGTGACTGGCCGGCTGCCACG
CAGTGTATGCTGGCGGGGAGCAACGGCTGGTTTGAGAATCACGCTGCGTGGAATCAGGGGGCTAATAACCGGTGG
GCTGTCGATAATACGCCTTGGAGCATTGGCTTCTATAAGCGGTGCGACGTTCCCGTGCAGTGGGCGCTTGCTGAC
GGCTGGATCGTCGCCGACATGTATCAAGAATCCGTCGTGGCATCCACCTCCCCCAACAGAGTAACCTGGATCAGC
GGCTCCATCAACGTACCCGGAAGCCCACAGAGGCCAGACCAAGGAGGGAACCCTTACATCGACAACAACGAGACG
CCCGGCTGTGAAAAGGGCGGCATCAACTGCTACCCGCTCAAGTGGAAGACGGCAGCTGAGCTTTACCAGGAAGCC
GGTGTGTCGTGGCAGGTGTATCAGGACGCTGACAACTTTGACGATAACCCGTTTGCCTGGTTCAAGCAGTTCCAG
GATGCGAGAAAGGGGTCGAGTTTACATAGTAGAGGAGTCAAGGGTCTTTCACTCGATGTCTTTTACCGGCAGGCT
GCCAACGGCACCCTCCCCGAGATATCCTACATCGTCGGTCCAACAGAGCTATCAGAACACACGCCCTACTCCCCC
CACGACGGCGCCTGGCTCCAACGCAAGATCGCCTCAGCCATCACCTCATCACCCAAATACGCAAACACCGTCCTC
ATAATCTCCTACGACGAAACAGGCGGCTGGTTCGACCACGTAGATCCCTTCCGCGCCCCCGACGGCACACCAGGC
GAATGGCTCGACGACCCTTACAGCCAAGTAGGCCATACCTTCTCCGGCCCAGGCTTCCGCGTGCCAATGTACATC
ATCTCCCCCTGGACGCGACGAGGCGGCGTCTACACCGAGCACGCCGATCATAACTCGCAGCTGCTCTTCATCGAG
CGCTGGCAGTCCGCCAAGGGACGCAACGTGACGACGCGGGAGATGGGGCCCTGGCGGAGGGAGAAGATGGGCGAT
CTCGTCGCTGCCTTTGACTTTTCCAGACCGGATTATAGCCTGCCTGTCTTACCGGAGGCGCCGGAACCGCATAAG
GATGGGAGGGGGGTTTATGATGGTTCGGCGCATTGTATGGCGCTCTTCGATGCTACGAGACCTCCTGTTCCGTAC
AAGGGGAGGGGTGTCATCGACGACATGGCCTCTCAGGTGGAAAAGGGCTTCAAATCTATCCGCGGACGCCTCACC
GAAGGCCGCTTCCTCGTCCTAGAGATGGAATCCCACGCACTGACAGCCTCTCCTGAAGCCAACAAGGCAACCCTC
ACAGCCAGCACAGAACAGCACGACTGCCCTCAGCAGCGATGGATTGCCCACGCCAAGGAGAGAGGCGGGGATGAG
TTTACGCTGAGCAGTGCCGTCGATGGCCGCTTTCTTTGCGGGGAGGCAGAGTTGTGTCAGTTACGAGGTTGA
Gene >Ophun1|3412
ATGCCCATCACCATGGCTCTCCTTGGGCTCTACGCCCTCTTCGCCCATGGCATCTACGCCGCCAACACCGCCAGC
CTAGCAGACATCGACCACGTCGTCCTCTTCATGCAAGGTCCATGCCGAACCCAACCCCCCTCACGCCCAGCTAAC
AACAGCAGAGAACCGCGCCTTCGACCACTACCTAGGCACCATGGCCGGCGTCCGCGGCTTCAAAGACGCCAACCT
CCAGCTCAACAACGGCGTCACCGTGTGGAAGCAGCTGACGAGCCCCAAACTGACAAACGACTCGGGCTTCGTCTC
TCCTTGGTATCTCAACTATCTGGCGGGTGACTGGCCGGCTGCCACGCAGTGTATGCTGGCGGGGAGCAACGGCTG
GTTTGAGAATCACGCTGCGTGGAATCAGGGGGCTAATAACCGGTGGGCTGTCGATAATACGCCTTGGAGCATTGG
CTTCTATAAGCGGTGCGACGTTCCCGTGCAGTGGGCGCTTGCTGACGGCTGGATCGTCGCCGACATGTATCAAGT
ACGCACCACAATCCCCATCCCAAGTCCACAAGCTCATCTCCCAGGAATCCGTCGTGGCATCCACCTCCCCCAACA
GAGTAACCTGGATCAGCGGCTCCATCAACGTACCCGGAAGCCCACAGAGGCCAGACCAAGGAGGGAACCCTTACA
TCGACAACAACGAGACGCCCGGCTGTGAAAAGGGCGGCATCAACTGCTACCCGCTCAAGTGGAAGACGGCAGCTG
AGCTTTACCAGGAAGCCGGTGTGTCGTGGCAGGTGTATCAGGACGCTGACAACTTTGACGATAACCCGTTTGCCT
GGTTCAAGCAGTTCCAGGATGCGAGAAAGGGGTCGAGTTTACATAGTAGAGGAGTCAAGGGTCTTTCACTCGATG
TCTTTTACCGGCAGGCTGCCAACGGCACCCTCCCCGAGATATCCTACATCGTCGGTCCAACAGAGCTATCAGAAC
ACACGCCCTACTCCCCCCACGACGGCGCCTGGCTCCAACGCAAGATCGCCTCAGCCATCACCTCATCACCCAAAT
ACGCAAACACCGTCCTCATAATCTCCTACGACGAAACAGGCGGCTGGTTCGACCACGTAGATCCCTTCCGCGCCC
CCGACGGCACACCAGGCGAATGGCTCGACGACCCTTACAGCCAAGTAGGCCATACCTTCTCCGGCCCAGGCTTCC
GCGTGCCAATGTACATCATCTCCCCCTGGACGCGACGAGGCGGCGTCTACACCGAGCACGCCGATCATAACTCGC
AGCTGCTCTTCATCGAGCGCTGGCAGTCCGCCAAGGGACGCAACGTGACGACGCGGGAGATGGGGCCCTGGCGGA
GGGAGAAGATGGGCGATCTCGTCGCTGCCTTTGACTTTTCCAGACCGGATTATAGCCTGCCTGTCTTACCGGAGG
CGCCGGAACCGCATAAGGATGGGAGGGGGGTTTATGATGGTTCGGCGCATTGTATGGCGCTCTTCGATGCTACGA
GACCTCCTGTTCCGTACAAGGGGAGGGGTGTCATCGACGACATGGCCTCTCAGGTGGAAAAGGGCTTCAAATCTA
TCCGCGGACGCCTCACCGAAGGCCGCTTCCTCGTCCTAGAGATGGAATCCCACGCACTGACAGCCTCTCCTGAAG
CCAACAAGGCAACCCTCACAGCCAGCACAGAACAGCACGACTGCCCTCAGCAGCGATGGATTGCCCACGCCAAGG
AGAGAGGCGGGGATGAGTTTACGCTGAGCAGTGCCGTCGATGGCCGCTTTCTTTGCGGGGAGGCAGAGTTGTGTC
GTGAGGAGGGGAGGGCGTTGACGATGGTGGTTGACTTTTTGCCTGGCGAGGGGCATGCGTTTCGGGTTGGGGGGG
TGTATTTGGGCGTTATTAACGGGGAGGTGGGCTTTGTAAGGGAAGAGAAGAAGTGGAGGATGTTTTCTGTGAGTT
ATTAATGATGCAGAGTTGTTGTTGTAGTGTTAAGGTGTAGTTGGCTTGTTACGTTTGAGTCGATGTTTAGGAGTT
GTAGCTGCTAAGTGCCGTAGAGTTACGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail