Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3411
Gene name
LocationContig_301:8955..12110
Strand+
Gene length (bp)3155
Transcript length (bp)2928
Coding sequence length (bp)2928
Protein length (aa) 976

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 3.0E-05 779 818
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-06 777 841
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.8E-07 780 855
PF13191 AAA_16 AAA ATPase domain 8.1E-08 150 277
PF05729 NACHT NACHT domain 8.2E-07 157 275
PF13401 AAA_22 AAA domain 2.1E-06 152 287

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3411
MTSWDGDAEQTQQTRASEQQLLHQFGCSTLEQTTMRWTMIEKQYRTKCIYEDKPTTGLGIVVTGEEDNLSQLDAE
HNELGFKWLRFAGAFGRIVYLENRSPIRDMSDQLKTAINCRLALSKSFPHDQRPGRILSDADLSIMDGEWNFTLE
QAGGIFTVIGSSGFGKTTLAKHVAQSRAQNMQVGRVLSFYFSKADYRRRSYRDLLYSFVLQLLYDKLDAFQSAHM
EKIFSSVTNMSKLTSPNLFGLLRAMMAALGQRTFVIIIDSIHECDEESRKQLMDDLKIIYESAEDGDVLIMVTCK
LTEDIEQSLGPFDINNSFELVDWMGDARATTLRQFDDSAALREFRAVMRERNATPLTALLAGALTAQNPENVPNP
RSLNSYGEFYRAILSRTPGDKTWIRDILCLVAYSDRPLTIPELAVALIVDRSAWEGERITLESVRIAVTEGLLTE
LSRTLRESLPHLVFIKDNAVHLVSDTFRKYIRQQPQLGLRMPHFGGAPATDRTLRCLMLRKCLTILSIPEILRTF
ANYAGYSLKRIMNDSIADFTGREAKLVRDEIMEFWNNRETRKWWIKTFHEDIDPSQPSLLLAAVLGLRPVLQSLL
ENVEDKNSIRAVALAAVKHDQLETLRLLSDALIDDDSSAEEDPGDSALEVEFTFMAINEACKSSSVGLADYILSD
SPRIPIDDIKKNLVVLAGNGNWHIAPRLLQEGVCFVRTLGREVVVSLIEKAASLGREGFIQSLLGKCKLDREFDS
LLKVNVQLDNAFFNAAVFGSAEVAVSDAAFHAAAMNGNTEFVMKMLNYGMNVNALDHNFKTALHKAIEKQICNED
MIDLLVSKDCSIDQQDGEGHSVFYYAIRNNFKFTRNLWDPRHEISKRGISILFDAASKGNAGRVRQLLAAGYDKD
EKDKWGRTAADVAVQANVRALLVESEEPRGRACRMVQSEDVVSRLWACYNCQQVLDNVAFYRELHPRTYIWFPLF
*
Coding >Ophun1|3411
ATGACTTCCTGGGACGGTGACGCCGAACAGACTCAACAGACCCGGGCAAGCGAGCAGCAACTGCTTCATCAGTTT
GGATGTTCGACTCTGGAGCAGACGACGATGCGCTGGACAATGATTGAGAAACAATATCGGACCAAGTGCATTTAC
GAAGACAAGCCAACGACTGGCCTGGGCATTGTAGTGACCGGGGAAGAAGACAACCTTAGTCAACTGGACGCAGAA
CACAACGAGCTTGGCTTCAAGTGGTTGAGGTTCGCGGGAGCCTTTGGCAGAATCGTCTATCTGGAGAACCGTAGC
CCAATCAGGGACATGTCGGACCAACTCAAGACCGCCATCAATTGTCGTTTAGCTCTTTCCAAATCTTTCCCGCAC
GACCAAAGACCAGGAAGGATCCTCAGCGATGCAGACTTGTCCATCATGGACGGTGAATGGAACTTTACTCTCGAA
CAAGCAGGCGGCATATTCACTGTTATTGGCAGTTCAGGATTTGGAAAGACGACGCTGGCTAAACACGTCGCTCAA
AGCAGGGCACAGAACATGCAAGTCGGAAGGGTACTATCCTTCTACTTCAGCAAGGCCGACTACCGCAGACGGTCA
TACCGAGATCTGCTGTACTCTTTTGTTCTTCAACTCTTATACGACAAGCTCGATGCTTTTCAGAGCGCACATATG
GAAAAGATCTTTTCTAGCGTGACGAACATGTCCAAGTTGACGTCGCCGAATCTTTTTGGACTCTTGCGGGCCATG
ATGGCAGCTTTGGGCCAGAGGACTTTTGTCATCATCATCGATTCGATCCATGAGTGCGACGAGGAGAGCAGGAAG
CAACTGATGGATGATCTGAAAATCATCTACGAGTCTGCTGAGGACGGAGACGTCTTGATCATGGTGACTTGCAAA
CTCACCGAGGACATTGAACAAAGCCTGGGCCCATTTGACATCAACAACAGCTTCGAACTGGTTGACTGGATGGGA
GACGCAAGAGCGACTACGCTGAGGCAGTTCGATGACAGTGCAGCGCTTCGGGAATTCAGGGCTGTGATGCGTGAG
CGGAATGCAACGCCCCTGACGGCACTGCTGGCCGGAGCCTTGACAGCTCAAAACCCTGAGAATGTCCCGAATCCC
AGGTCGTTGAACAGCTATGGCGAATTCTATCGTGCCATTCTCTCGCGTACCCCTGGAGACAAGACCTGGATTCGA
GACATCTTGTGCCTGGTCGCCTATTCCGACCGACCCCTGACAATCCCTGAGCTGGCTGTGGCCCTCATCGTGGAC
CGCTCCGCTTGGGAGGGCGAAAGGATAACCCTGGAAAGCGTCCGGATTGCTGTGACGGAGGGGCTGCTCACTGAA
CTGTCACGGACTCTGAGGGAGTCGCTTCCGCACCTGGTTTTCATCAAAGACAACGCTGTTCACCTCGTCAGCGAC
ACGTTCCGCAAGTATATTCGTCAACAGCCGCAGCTTGGTCTTCGCATGCCTCATTTCGGGGGGGCTCCGGCTACG
GACAGGACTTTGCGGTGTCTCATGCTGCGCAAGTGTCTTACTATCCTCTCTATTCCTGAGATACTTCGCACTTTT
GCAAACTACGCTGGCTACTCTCTGAAACGAATTATGAACGATTCCATTGCGGATTTCACTGGTCGAGAAGCCAAG
CTGGTCAGAGACGAAATCATGGAATTCTGGAACAACAGAGAGACTCGGAAGTGGTGGATCAAGACGTTTCACGAG
GATATCGATCCATCGCAGCCATCCCTGTTGTTGGCGGCTGTTTTGGGATTGCGGCCCGTGCTGCAGTCTTTGTTG
GAGAACGTCGAGGACAAGAATTCGATTCGAGCCGTGGCATTGGCCGCCGTGAAACACGATCAGTTGGAAACGCTC
CGGTTGCTCTCAGACGCTCTTATCGATGACGACTCGTCGGCTGAGGAGGATCCAGGTGACTCTGCACTTGAAGTG
GAGTTTACCTTCATGGCCATCAACGAGGCCTGCAAGTCCAGCTCCGTTGGTCTTGCAGACTACATCCTCTCCGAC
TCCCCACGCATCCCAATCGACGACATCAAGAAGAATCTCGTCGTTCTAGCGGGCAACGGAAACTGGCACATTGCC
CCTCGACTGCTGCAAGAGGGCGTCTGCTTCGTCCGGACTCTCGGCCGGGAGGTTGTCGTGTCGCTGATTGAAAAG
GCGGCGTCTTTGGGCAGAGAGGGCTTCATTCAGTCGCTGCTGGGCAAGTGTAAGCTTGACCGGGAGTTTGACAGC
CTTTTGAAAGTCAATGTTCAGCTTGACAATGCGTTTTTCAACGCGGCTGTGTTTGGGAGCGCCGAGGTGGCTGTG
AGCGACGCAGCGTTCCATGCGGCTGCGATGAACGGAAATACCGAGTTTGTGATGAAAATGCTCAACTATGGAATG
AACGTCAATGCCCTCGACCACAACTTCAAGACGGCTCTGCACAAAGCCATCGAAAAACAAATCTGCAACGAGGAC
ATGATCGATCTTCTCGTCTCCAAAGACTGCTCAATCGACCAACAAGACGGTGAAGGCCACTCGGTATTCTACTAC
GCCATCAGAAACAACTTCAAGTTCACACGCAACCTCTGGGACCCGCGCCACGAAATCTCCAAGCGAGGCATCTCG
ATTCTCTTCGACGCGGCCTCCAAGGGTAACGCTGGGAGGGTGAGGCAACTACTCGCAGCAGGGTACGACAAGGAC
GAAAAGGACAAATGGGGGAGAACGGCAGCAGACGTCGCCGTCCAAGCCAACGTTCGCGCCCTGCTCGTCGAGTCT
GAGGAGCCTCGTGGACGGGCATGTCGAATGGTTCAGTCCGAGGACGTTGTGAGTCGACTTTGGGCGTGTTACAAC
TGCCAGCAGGTCCTCGATAACGTGGCCTTTTACCGTGAGCTTCACCCGCGAACATACATATGGTTTCCGCTGTTC
TGA
Transcript >Ophun1|3411
ATGACTTCCTGGGACGGTGACGCCGAACAGACTCAACAGACCCGGGCAAGCGAGCAGCAACTGCTTCATCAGTTT
GGATGTTCGACTCTGGAGCAGACGACGATGCGCTGGACAATGATTGAGAAACAATATCGGACCAAGTGCATTTAC
GAAGACAAGCCAACGACTGGCCTGGGCATTGTAGTGACCGGGGAAGAAGACAACCTTAGTCAACTGGACGCAGAA
CACAACGAGCTTGGCTTCAAGTGGTTGAGGTTCGCGGGAGCCTTTGGCAGAATCGTCTATCTGGAGAACCGTAGC
CCAATCAGGGACATGTCGGACCAACTCAAGACCGCCATCAATTGTCGTTTAGCTCTTTCCAAATCTTTCCCGCAC
GACCAAAGACCAGGAAGGATCCTCAGCGATGCAGACTTGTCCATCATGGACGGTGAATGGAACTTTACTCTCGAA
CAAGCAGGCGGCATATTCACTGTTATTGGCAGTTCAGGATTTGGAAAGACGACGCTGGCTAAACACGTCGCTCAA
AGCAGGGCACAGAACATGCAAGTCGGAAGGGTACTATCCTTCTACTTCAGCAAGGCCGACTACCGCAGACGGTCA
TACCGAGATCTGCTGTACTCTTTTGTTCTTCAACTCTTATACGACAAGCTCGATGCTTTTCAGAGCGCACATATG
GAAAAGATCTTTTCTAGCGTGACGAACATGTCCAAGTTGACGTCGCCGAATCTTTTTGGACTCTTGCGGGCCATG
ATGGCAGCTTTGGGCCAGAGGACTTTTGTCATCATCATCGATTCGATCCATGAGTGCGACGAGGAGAGCAGGAAG
CAACTGATGGATGATCTGAAAATCATCTACGAGTCTGCTGAGGACGGAGACGTCTTGATCATGGTGACTTGCAAA
CTCACCGAGGACATTGAACAAAGCCTGGGCCCATTTGACATCAACAACAGCTTCGAACTGGTTGACTGGATGGGA
GACGCAAGAGCGACTACGCTGAGGCAGTTCGATGACAGTGCAGCGCTTCGGGAATTCAGGGCTGTGATGCGTGAG
CGGAATGCAACGCCCCTGACGGCACTGCTGGCCGGAGCCTTGACAGCTCAAAACCCTGAGAATGTCCCGAATCCC
AGGTCGTTGAACAGCTATGGCGAATTCTATCGTGCCATTCTCTCGCGTACCCCTGGAGACAAGACCTGGATTCGA
GACATCTTGTGCCTGGTCGCCTATTCCGACCGACCCCTGACAATCCCTGAGCTGGCTGTGGCCCTCATCGTGGAC
CGCTCCGCTTGGGAGGGCGAAAGGATAACCCTGGAAAGCGTCCGGATTGCTGTGACGGAGGGGCTGCTCACTGAA
CTGTCACGGACTCTGAGGGAGTCGCTTCCGCACCTGGTTTTCATCAAAGACAACGCTGTTCACCTCGTCAGCGAC
ACGTTCCGCAAGTATATTCGTCAACAGCCGCAGCTTGGTCTTCGCATGCCTCATTTCGGGGGGGCTCCGGCTACG
GACAGGACTTTGCGGTGTCTCATGCTGCGCAAGTGTCTTACTATCCTCTCTATTCCTGAGATACTTCGCACTTTT
GCAAACTACGCTGGCTACTCTCTGAAACGAATTATGAACGATTCCATTGCGGATTTCACTGGTCGAGAAGCCAAG
CTGGTCAGAGACGAAATCATGGAATTCTGGAACAACAGAGAGACTCGGAAGTGGTGGATCAAGACGTTTCACGAG
GATATCGATCCATCGCAGCCATCCCTGTTGTTGGCGGCTGTTTTGGGATTGCGGCCCGTGCTGCAGTCTTTGTTG
GAGAACGTCGAGGACAAGAATTCGATTCGAGCCGTGGCATTGGCCGCCGTGAAACACGATCAGTTGGAAACGCTC
CGGTTGCTCTCAGACGCTCTTATCGATGACGACTCGTCGGCTGAGGAGGATCCAGGTGACTCTGCACTTGAAGTG
GAGTTTACCTTCATGGCCATCAACGAGGCCTGCAAGTCCAGCTCCGTTGGTCTTGCAGACTACATCCTCTCCGAC
TCCCCACGCATCCCAATCGACGACATCAAGAAGAATCTCGTCGTTCTAGCGGGCAACGGAAACTGGCACATTGCC
CCTCGACTGCTGCAAGAGGGCGTCTGCTTCGTCCGGACTCTCGGCCGGGAGGTTGTCGTGTCGCTGATTGAAAAG
GCGGCGTCTTTGGGCAGAGAGGGCTTCATTCAGTCGCTGCTGGGCAAGTGTAAGCTTGACCGGGAGTTTGACAGC
CTTTTGAAAGTCAATGTTCAGCTTGACAATGCGTTTTTCAACGCGGCTGTGTTTGGGAGCGCCGAGGTGGCTGTG
AGCGACGCAGCGTTCCATGCGGCTGCGATGAACGGAAATACCGAGTTTGTGATGAAAATGCTCAACTATGGAATG
AACGTCAATGCCCTCGACCACAACTTCAAGACGGCTCTGCACAAAGCCATCGAAAAACAAATCTGCAACGAGGAC
ATGATCGATCTTCTCGTCTCCAAAGACTGCTCAATCGACCAACAAGACGGTGAAGGCCACTCGGTATTCTACTAC
GCCATCAGAAACAACTTCAAGTTCACACGCAACCTCTGGGACCCGCGCCACGAAATCTCCAAGCGAGGCATCTCG
ATTCTCTTCGACGCGGCCTCCAAGGGTAACGCTGGGAGGGTGAGGCAACTACTCGCAGCAGGGTACGACAAGGAC
GAAAAGGACAAATGGGGGAGAACGGCAGCAGACGTCGCCGTCCAAGCCAACGTTCGCGCCCTGCTCGTCGAGTCT
GAGGAGCCTCGTGGACGGGCATGTCGAATGGTTCAGTCCGAGGACGTTGTGAGTCGACTTTGGGCGTGTTACAAC
TGCCAGCAGGTCCTCGATAACGTGGCCTTTTACCGTGAGCTTCACCCGCGAACATACATATGGTTTCCGCTGTTC
TGA
Gene >Ophun1|3411
ATGACTTCCTGGGACGGTGACGCCGAACAGACTCAACAGACCCGGGCAAGCGAGCAGCAACTGCTTCATCAGTTT
GGATGTTCGACTCTGGAGCAGACGACGATGCGCTGGACAATGATTGAGAAACAATATCGGACCAAGTGCATTTAC
GAAGACAAGCCAACGACTGGCCTGGGCATTGTAGTGAGTACATGCAGCCAGATCCATACTGCAAGAAGCGTTGAA
ACTGACGATGTTGAAGGTGACCGGGGAAGAAGACAACCTTAGTCAACTGGACGCAGAACACAACGAGCTTGGCTT
CAAGTGGTTGAGGTTCGCGGGAGCCTTTGGCAGAATCGTCTATCTGGAGAACCGTAGCCCAATCAGGGACATGTC
GGACCAACTCAAGACCGCCATCAATTGTCGTTTAGCTCTTTCCAAATCTTTCCCGCACGACCAAAGACCAGGAAG
GATCCTCAGCGATGCAGACTTGTCCATCATGGACGGTGAATGGAACTTTACTCTCGAACAAGCAGGCGGCATATT
CACTGTTATTGGCAGTTCAGGATTTGGAAAGACGACGCTGGCTAAACACGTCGCTCAAAGCAGGGCACAGAACAT
GCAAGTCGGAAGGGTACTATCCTTCTACTTCAGCAAGGCCGACTACCGCAGACGGTCATACCGAGATCTGCTGTA
CTCTTTTGTTCTTCAACTCTTATACGACAAGCTCGATGCTTTTCAGAGCGCACATATGGAAAAGATCTTTTCTAG
CGTGACGAACATGTCCAAGTTGACGTCGCCGAATCTTTTTGGACTCTTGCGGGCCATGATGGCAGCTTTGGGCCA
GAGGACTTTTGTCATCATCATCGATTCGATCCATGAGTGCGACGAGGAGAGCAGGAAGCAACTGATGGATGATCT
GAAAATCATCTACGAGTCTGCTGAGGACGGAGACGTCTTGATCATGGTGACTTGCAAACTCACCGAGGACATTGA
ACAAAGCCTGGGCCCATTTGACATCAACAACAGCTTCGAACTGGTTGACTGGATGGGAGACGCAAGAGCGACTAC
GCTGAGGCAGTTCGATGACAGTGCAGCGCTTCGGGAATTCAGGGCTGTGATGCGTGAGCGGAATGCAACGCCCCT
GACGGCACTGCTGGCCGGAGCCTTGACAGCTCAAAACCCTGAGAATGTCCCGAATCCCAGGTCGTTGAACAGCTA
TGGCGAATTCTATCGTGCCATTCTCTCGCGTACCCCTGGAGACAAGACCTGGATTCGAGACATCTTGTGCCTGGT
CGCCTATTCCGACCGACCCCTGACAATCCCTGAGCTGGCTGTGGCCCTCATCGTGGACCGCTCCGCTTGGGAGGG
CGAAAGGATAACCCTGGAAAGCGTCCGGATTGCTGTGACGGAGGGGCTGCTCACTGAACTGTCACGGACTCTGAG
GGAGTCGCTTCCGCACCTGGTTTTCATCAAAGACAACGCTGTTCACCTCGTCAGCGACACGTTCCGCAAGTATAT
TCGTCAACAGCCGCAGCTTGGTCTTCGCATGCCTCATTTCGGGGGGGCTCCGGCTACGGACAGGACTTTGCGGTG
TCTCATGCTGCGCAAGTGTCTTACTATCCTCTCTATTCCTGAGATACGTGAGCCTGGCATGTTGCCGATTGAGAC
GGACTTTTATGCCGTTCTTAACCTCGCAGGACCAGTTCGCACTTTTGCAAACTACGCTGGCTACTCTCTGAAACG
AATTATGAACGATTCCATTGCGGATTTCACTGGTCGAGAAGCCAAGCTGGTCAGAGACGAAATCATGGAATTCTG
GAACAACAGAGAGACTCGGAAGTGGTGGATCAAGACGTTTCACGAGGATATCGATCCATCGCAGCCATCCCTGTT
GTTGGCGGCTGTTTTGGGATTGCGGCCCGTGCTGCAGTCTTTGTTGGAGAACGTCGAGGACAAGAATTCGATTCG
AGCCGTGGCATTGGCCGCCGTGAAACACGATCAGTTGGAAACGCTCCGGTTGCTCTCAGACGCTCTTATCGATGA
CGACTCGTCGGCTGAGGAGGATCCAGGTGACTCTGCACTTGAAGTGGAGTTTACCTTCATGGCCATCAACGAGGC
CTGCAAGTCCAGCTCCGTTGGTCTTGCAGACTACATCCTCTCCGACTCCCCACGCATCCCAATCGACGACATCAA
GAAGAATCTCGTCGTTCTAGCGGGCAACGGAAACTGGCACATTGCCCCTCGACTGCTGCAAGAGGGCGTCTGCTT
CGTCCGGACTCTCGGCCGGGAGGTTGTCGTGTCGCTGATTGAAAAGGCGGCGTCTTTGGGCAGAGAGGGCTTCAT
TCAGTCGCTGCTGGGCAAGTGTAAGCTTGACCGGGAGTTTGACAGCCTTTTGAAAGTCAATGTTCAGCTTGACAA
TGCGTTTTTCAACGCGGCTGTGTTTGGGAGCGCGTATGTGTTTGAGCTGTTGATGCCATACGTCGCTCCTGGCGT
GGCGATCAGCGAGGTGGCTGTGAGCGACGCAGCGTTCCATGCGGCTGCGATGAGTATGTTCTGTTGATTTGAGTT
GAGAACTGGAGAGATAACTAACTGACCTTGCAGACGGAAATACCGAGTTTGTGATGAAAATGCTCAACTATGGAA
TGAACGTCAATGCCCTCGACCACAACTTCAAGACGGCTCTGCACAAAGCCATCGAAAAACAAATCTGCAACGAGG
ACATGATCGATCTTCTCGTCTCCAAAGACTGCTCAATCGACCAACAAGACGGTGAAGGCCACTCGGTATTCTACT
ACGCCATCAGAAACAACTTCAAGTTCACACGCAACCTCTGGGACCCGCGCCACGAAATCTCCAAGCGAGGCATCT
CGATTCTCTTCGACGCGGCCTCCAAGGGTAACGCTGGGAGGGTGAGGCAACTACTCGCAGCAGGGTACGACAAGG
ACGAAAAGGACAAATGGGGGAGAACGGCAGCAGACGTCGCCGTCCAAGCCAACGTTCGCGCCCTGCTCGTCGAGT
CTGAGGAGCCTCGTGGACGGGCATGTCGAATGGTTCAGTCCGAGGACGTTGTGAGTCGACTTTGGGCGTGTTACA
ACTGCCAGCAGGTCCTCGATAACGTGGCCTTTTACCGTGAGCTTCACCCGCGAACATACATATGGTTTCCGCTGT
TCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail