Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3410
Gene name
LocationContig_301:5128..6739
Strand+
Gene length (bp)1611
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-09 28 177
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.0E-14 310 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 309 460 5.0E-32
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 280 460 1.0E-28
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 310 462 4.0E-25
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 284 452 1.0E-23
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 309 453 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 309 460 5.0E-32
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 280 460 1.0E-28
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 310 462 4.0E-25
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 284 452 1.0E-23
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 309 453 2.0E-20
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 305 452 2.0E-20
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 302 457 5.0E-20
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 284 454 8.0E-20
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 289 452 1.0E-19
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 320 462 2.0E-19
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 309 452 2.0E-19
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 284 452 2.0E-19
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 309 452 2.0E-18
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 289 452 3.0E-17
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 4 177 2.0E-14
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 1 150 6.0E-14
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 327 452 8.0E-14
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 324 457 1.0E-13
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 2 180 6.0E-13
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 1 180 1.0E-12
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 2 180 2.0E-11
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 1 192 4.0E-11
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 2 180 8.0E-11
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 301 452 9.0E-11
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 10 202 1.0E-10
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 9 202 1.0E-09
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 14 180 2.0E-09
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 30 182 3.0E-08
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 1 177 6.0E-07
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 30 177 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 40 0.588157

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 86 108 22
3 121 143 22
4 153 175 22
5 307 329 22
6 344 366 22
7 373 395 22
8 405 427 22
9 440 462 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6101
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|727
Ophiocordyceps camponoti-floridani Ophcf2|03024
Ophiocordyceps camponoti-rufipedis Ophun1|3410 (this protein)
Ophiocordyceps kimflemingae Ophio5|2675
Ophiocordyceps subramaniannii Hirsu2|3359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3410
MILSSPLNALLVFVPVGLASEMAGLGPIIVFATNAAAIVPLSALLTDATERVAAHAGDTVVRLSRDETFTHLLSA
ALCHDHVRIVQASILGSVLVNLLLILGSALIVGNDEPAYNAADAQLLACLLSVSVFTFLIPTAFNFAFSSASRSS
GLISLSFSRISSLLILAIYVLYLVHEIRPRCRPVVLVDLESSLSAAERHRLPPPLLPLNNLPQPLSPRTIRFVED
TLHPGRGRRLVDSAAGFRPRADSWQPSMSRKVSPSRRDSSVGDIRRNFSRSSLTLQILRDVHLDRDQPVSEDDGQ
GSRKEVIVAIAMLVLTSALMSLNAELLVGTINDVTRQTNLSEPVIGLILLPIVGNVAEYVTVVAVAAREKLDLAV
AVAVGSSIQIALCVTPLTVLAGWVLHRDLALTFNTFEMATLVGAVLLVNLLVLSETGSTLRTGGLKGVLMCACYF
IIGLGAYFAPAIEA*
Coding >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGTTCGGCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCC
GCCCTCTGTCACGACCACGTTCGCATCGTCCAGGCCTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATC
CTCGGCTCAGCTCTTATTGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTG
CTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTACGGCCTTCAACTTTGCCTTTAGCTCTGCGTCGCGCTCCTCG
GGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTTCTCTACCTAGTTCAC
GAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCCGCAGCAGAGAGACATCGA
CTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACGATTCGTTTCGTCGAAGAT
ACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCGCGTGCCGACTCGTGGCAG
CCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATACGAAGAAACTTCTCGCGG
TCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTCAGCGAAGACGATGGCCAA
GGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTCATGTCCCTCAACGCCGAG
CTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTCATCGGCCTCATCCTGCTG
CCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTCGATCTCGCTGTG
GCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTCCTTGCTGGCTGGGTTCTG
CATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCCGTCTTGCTCGTCAATCTG
CTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTGATGTGCGCCTGTTACTTT
ATCATTGGTTTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG
Transcript >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGTTCGGCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCC
GCCCTCTGTCACGACCACGTTCGCATCGTCCAGGCCTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATC
CTCGGCTCAGCTCTTATTGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTG
CTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTACGGCCTTCAACTTTGCCTTTAGCTCTGCGTCGCGCTCCTCG
GGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTTCTCTACCTAGTTCAC
GAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCCGCAGCAGAGAGACATCGA
CTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACGATTCGTTTCGTCGAAGAT
ACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCGCGTGCCGACTCGTGGCAG
CCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATACGAAGAAACTTCTCGCGG
TCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTCAGCGAAGACGATGGCCAA
GGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTCATGTCCCTCAACGCCGAG
CTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTCATCGGCCTCATCCTGCTG
CCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTCGATCTCGCTGTG
GCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTCCTTGCTGGCTGGGTTCTG
CATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCCGTCTTGCTCGTCAATCTG
CTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTGATGTGCGCCTGTTACTTT
ATCATTGGTTTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG
Gene >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGGTGCGCTGCTCAACATTAGTCTTGGGAACTTGGTTGAGCTCATC
TTGTTGTATGGCTTTCTCTTCTGCGTTTTTTGTGTTGTAGCTGGCTAACTGTCTGTACTCTAGCATGTAAGTTCG
GCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCCGCCCTCTGTCACGACCACGTTCGCATCGTCCAGGC
CTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATCCTCGGCTCAGCTCTTATTGTCGGCAATGACGAACC
GGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTGCTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTGT
GAGAACTCTTTCTCTGTTCTCGATAACACTAACACTGACTCACTTTGGAAGACGGCCTTCAACTTTGCCTTTAGC
TCTGCGTCGCGCTCCTCGGGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTAC
GTTCTCTACCTAGTTCACGAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCC
GCAGCAGAGAGACATCGACTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACG
ATTCGTTTCGTCGAAGATACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCG
CGTGCCGACTCGTGGCAGCCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATA
CGAAGAAACTTCTCGCGGTCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTC
AGCGAAGACGATGGCCAAGGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTC
ATGTCCCTCAACGCCGAGCTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTC
ATCGGCCTCATCCTGCTGCCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAG
AAGCTCGATCTCGCTGTGGCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTC
CTTGCTGGCTGGGTTCTGCATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCC
GTCTTGCTCGTCAATCTGCTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTG
ATGTGCGCCTGTTACTTTATCATTGGGTGAGTGCTTCTTCAAAGAGCCAGACGTGTTTCTGACTCGTCTTGCAGT
TTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail