Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3410
Gene name
LocationContig_301:5128..6739
Strand+
Gene length (bp)1611
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-09 28 177
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.0E-14 310 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 309 460 5.0E-32
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 280 460 1.0E-28
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 310 462 4.0E-25
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 284 452 1.0E-23
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 309 453 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 309 460 5.0E-32
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 280 460 1.0E-28
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 310 462 4.0E-25
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 284 452 1.0E-23
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 309 453 2.0E-20
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 305 452 2.0E-20
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 302 457 5.0E-20
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 284 454 8.0E-20
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 289 452 1.0E-19
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 320 462 2.0E-19
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 309 452 2.0E-19
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 284 452 2.0E-19
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 309 452 2.0E-18
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 289 452 3.0E-17
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 4 177 2.0E-14
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 1 150 6.0E-14
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 327 452 8.0E-14
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 324 457 1.0E-13
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 2 180 6.0E-13
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 1 180 1.0E-12
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 2 180 2.0E-11
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 1 192 4.0E-11
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 2 180 8.0E-11
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 301 452 9.0E-11
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 10 202 1.0E-10
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 9 202 1.0E-09
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 14 180 2.0E-09
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 30 182 3.0E-08
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 1 177 6.0E-07
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 30 177 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 86 108 22
3 121 143 22
4 153 175 22
5 307 329 22
6 344 366 22
7 373 395 22
8 405 427 22
9 440 462 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3410
MILSSPLNALLVFVPVGLASEMAGLGPIIVFATNAAAIVPLSALLTDATERVAAHAGDTVVRLSRDETFTHLLSA
ALCHDHVRIVQASILGSVLVNLLLILGSALIVGNDEPAYNAADAQLLACLLSVSVFTFLIPTAFNFAFSSASRSS
GLISLSFSRISSLLILAIYVLYLVHEIRPRCRPVVLVDLESSLSAAERHRLPPPLLPLNNLPQPLSPRTIRFVED
TLHPGRGRRLVDSAAGFRPRADSWQPSMSRKVSPSRRDSSVGDIRRNFSRSSLTLQILRDVHLDRDQPVSEDDGQ
GSRKEVIVAIAMLVLTSALMSLNAELLVGTINDVTRQTNLSEPVIGLILLPIVGNVAEYVTVVAVAAREKLDLAV
AVAVGSSIQIALCVTPLTVLAGWVLHRDLALTFNTFEMATLVGAVLLVNLLVLSETGSTLRTGGLKGVLMCACYF
IIGLGAYFAPAIEA*
Coding >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGTTCGGCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCC
GCCCTCTGTCACGACCACGTTCGCATCGTCCAGGCCTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATC
CTCGGCTCAGCTCTTATTGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTG
CTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTACGGCCTTCAACTTTGCCTTTAGCTCTGCGTCGCGCTCCTCG
GGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTTCTCTACCTAGTTCAC
GAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCCGCAGCAGAGAGACATCGA
CTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACGATTCGTTTCGTCGAAGAT
ACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCGCGTGCCGACTCGTGGCAG
CCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATACGAAGAAACTTCTCGCGG
TCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTCAGCGAAGACGATGGCCAA
GGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTCATGTCCCTCAACGCCGAG
CTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTCATCGGCCTCATCCTGCTG
CCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTCGATCTCGCTGTG
GCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTCCTTGCTGGCTGGGTTCTG
CATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCCGTCTTGCTCGTCAATCTG
CTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTGATGTGCGCCTGTTACTTT
ATCATTGGTTTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG
Transcript >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGTTCGGCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCC
GCCCTCTGTCACGACCACGTTCGCATCGTCCAGGCCTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATC
CTCGGCTCAGCTCTTATTGTCGGCAATGACGAACCGGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTG
CTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTACGGCCTTCAACTTTGCCTTTAGCTCTGCGTCGCGCTCCTCG
GGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTACGTTCTCTACCTAGTTCAC
GAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCCGCAGCAGAGAGACATCGA
CTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACGATTCGTTTCGTCGAAGAT
ACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCGCGTGCCGACTCGTGGCAG
CCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATACGAAGAAACTTCTCGCGG
TCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTCAGCGAAGACGATGGCCAA
GGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTCATGTCCCTCAACGCCGAG
CTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTCATCGGCCTCATCCTGCTG
CCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAGAAGCTCGATCTCGCTGTG
GCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTCCTTGCTGGCTGGGTTCTG
CATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCCGTCTTGCTCGTCAATCTG
CTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTGATGTGCGCCTGTTACTTT
ATCATTGGTTTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG
Gene >Ophun1|3410
ATGATTCTCTCGTCGCCGCTCAACGCGCTGCTCGTCTTCGTCCCCGTCGGGCTGGCCAGCGAGATGGCTGGTCTG
GGACCCATCATCGTCTTCGCGACGAATGCTGCCGCCATTGTGCCCTTGTCTGCGCTCTTGACGGATGCGACGGAG
AGGGTTGCTGCTCATGCTGGCGATACTGTTGGTGCGCTGCTCAACATTAGTCTTGGGAACTTGGTTGAGCTCATC
TTGTTGTATGGCTTTCTCTTCTGCGTTTTTTGTGTTGTAGCTGGCTAACTGTCTGTACTCTAGCATGTAAGTTCG
GCTCTCACGAGACGAAACCTTTACTCATCTTCTCAGCGCCGCCCTCTGTCACGACCACGTTCGCATCGTCCAGGC
CTCTATCCTCGGCTCTGTTCTCGTCAACCTGCTCCTTATCCTCGGCTCAGCTCTTATTGTCGGCAATGACGAACC
GGCTTACAACGCGGCCGATGCCCAGCTTCTCGCCTGCCTGCTCTCCGTCTCCGTCTTTACTTTTCTGATCCCTGT
GAGAACTCTTTCTCTGTTCTCGATAACACTAACACTGACTCACTTTGGAAGACGGCCTTCAACTTTGCCTTTAGC
TCTGCGTCGCGCTCCTCGGGCCTCATCAGCCTCAGCTTCAGCAGGATATCTTCCCTGCTTATCCTCGCCATCTAC
GTTCTCTACCTAGTTCACGAGATACGTCCCCGCTGCCGCCCCGTTGTTCTCGTCGATCTGGAGAGCAGTCTTTCC
GCAGCAGAGAGACATCGACTTCCACCACCCTTGCTTCCCCTGAACAACCTTCCGCAGCCGCTGTCTCCCCGGACG
ATTCGTTTCGTCGAAGATACGCTTCATCCTGGTCGAGGCCGTCGTCTTGTCGATTCTGCTGCTGGCTTCAGACCG
CGTGCCGACTCGTGGCAGCCGTCCATGTCGCGCAAAGTCTCGCCTTCAAGAAGGGACTCTTCTGTGGGGGATATA
CGAAGAAACTTCTCGCGGTCAAGCCTGACGCTTCAGATCCTTCGAGACGTCCATCTTGATCGAGATCAGCCCGTC
AGCGAAGACGATGGCCAAGGCAGTAGAAAGGAAGTCATCGTCGCCATCGCCATGCTCGTCCTGACCTCAGCCCTC
ATGTCCCTCAACGCCGAGCTCCTCGTCGGCACCATCAACGACGTGACGCGTCAGACGAACCTCTCAGAGCCCGTC
ATCGGCCTCATCCTGCTGCCCATCGTCGGAAATGTGGCCGAGTACGTGACCGTCGTTGCTGTAGCGGCTCGCGAG
AAGCTCGATCTCGCTGTGGCTGTTGCTGTTGGATCTTCCATTCAGATCGCCTTGTGCGTCACGCCGCTGACTGTC
CTTGCTGGCTGGGTTCTGCATCGCGACTTGGCCTTGACTTTCAACACGTTTGAGATGGCTACTCTTGTTGGTGCC
GTCTTGCTCGTCAATCTGCTTGTTCTTAGCGAGACGGGAAGTACTCTGCGGACTGGTGGACTCAAGGGCGTCTTG
ATGTGCGCCTGTTACTTTATCATTGGGTGAGTGCTTCTTCAAAGAGCCAGACGTGTTTCTGACTCGTCTTGCAGT
TTGGGAGCGTACTTTGCTCCGGCTATCGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail