Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3407
Gene name
LocationContig_300:18547..20245
Strand+
Gene length (bp)1698
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-19 59 246
PF00083 Sugar_tr Sugar (and other) transporter 2.5E-09 266 454
PF07690 MFS_1 Major Facilitator Superfamily 4.2E-12 83 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 8 473 2.0E-129
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 15 497 5.0E-74
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 40 425 7.0E-25
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 33 423 6.0E-22
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 31 419 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 8 473 2.0E-129
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 15 497 5.0E-74
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 40 425 7.0E-25
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 33 423 6.0E-22
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 31 419 2.0E-20
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 53 440 3.0E-20
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 53 440 5.0E-20
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 53 472 8.0E-20
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 27 440 3.0E-19
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 53 440 3.0E-19
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 49 424 9.0E-18
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 40 432 1.0E-17
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 49 423 1.0E-17
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 49 472 2.0E-17
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 49 424 2.0E-17
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 49 424 3.0E-17
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 17 426 5.0E-17
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 22 429 1.0E-16
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 49 421 2.0E-16
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 40 440 6.0E-16
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 40 440 2.0E-15
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 49 389 9.0E-15
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 53 454 1.0E-14
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 32 486 3.0E-14
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 49 449 6.0E-13
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 33 298 1.0E-12
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 25 480 2.0E-12
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 20 416 3.0E-12
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 53 258 4.0E-11
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 41 422 2.0E-09
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 40 298 3.0E-09
sp|Q6GBR4|PROP_STAAS Putative proline/betaine transporter OS=Staphylococcus aureus (strain MSSA476) GN=proP PE=3 SV=1 92 375 3.0E-09
sp|Q8NXW9|PROP_STAAW Putative proline/betaine transporter OS=Staphylococcus aureus (strain MW2) GN=proP PE=3 SV=1 92 375 3.0E-09
sp|Q7A771|PROP_STAAN Putative proline/betaine transporter OS=Staphylococcus aureus (strain N315) GN=proP PE=3 SV=1 92 375 6.0E-09
sp|Q99W36|PROP_STAAM Putative proline/betaine transporter OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=proP PE=3 SV=1 92 375 6.0E-09
sp|Q5HIA2|PROP_STAAC Putative proline/betaine transporter OS=Staphylococcus aureus (strain COL) GN=proP PE=3 SV=1 92 375 6.0E-09
sp|Q9KWK6|PROP_STAA1 Putative proline/betaine transporter OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=proP PE=3 SV=3 92 375 6.0E-09
sp|Q6GJ96|PROP_STAAR Putative proline/betaine transporter OS=Staphylococcus aureus (strain MRSA252) GN=proP PE=3 SV=1 92 353 1.0E-08
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 52 256 1.0E-08
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 72 357 3.0E-07
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 265 429 4.0E-06
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 34 469 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 118 137 19
3 187 209 22
4 219 238 19
5 258 280 22
6 308 330 22
7 337 357 20
8 367 389 22
9 402 424 22
10 439 461 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3407
MAIFSRFIGRHRPESSDAVAKSETPQVRDDALVEAQVDQRSFLHKAMPVFACGAGLFSDGYINNVIGSVNTVLRL
QYGDVYKKSTAASNVPAIAFAGTVVGQLVFGFASDRWSRSNSLMTSTVILIIFTALAAGSYYHGDPVAMFSMLAA
WRFFVGIGIGGEYPAGSVACAESSGELRSGTRNRWFILFTNSMIDWGFVFGAFIPYVIAAAAQNRNYSTIWRTSL
GIGVVFPLAMLLMRMRLKEPEEFARESMRRKTPYLLVLRYYWFRLFCVSLVWFLYDFSTYAFGIYVSSILSAIYG
DNASLTTVFGWSTVINTFYLPGTLIGALVSDWLGPKYTLIGGVTIQAIVGFIMAAVYDRISHNVAAFAVTYGLFL
TLGELGPGNNIGLLAAKTCATGVRGRYYGISAAIGKIGAFVGSYVFPYIQAAGGAPGSVQSAQYPFYVASSFCIL
SAAIAMCIPNIGQDTITREDAEFRAYLEAKGWDTSLLGLAKDDSQAVTYAEDEHQRQEPMKQ*
Coding >Ophun1|3407
ATGGCCATCTTCAGCCGCTTCATTGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGAGCGAAACTCCC
CAAGTCCGAGACGATGCCCTTGTCGAGGCTCAGGTCGATCAAAGGTCCTTTCTTCACAAGGCCATGCCCGTCTTC
GCCTGCGGAGCTGGTCTCTTCTCCGACGGTTACATCAATAATGTCATCGGCTCCGTCAACACGGTCCTCCGGCTC
CAATACGGCGACGTATACAAAAAGTCGACAGCAGCCTCCAACGTACCCGCCATTGCCTTTGCCGGCACCGTCGTC
GGTCAGCTCGTCTTCGGCTTCGCCTCGGATCGATGGTCTCGCTCCAACTCGTTGATGACGTCGACCGTCATTCTC
ATCATCTTTACAGCCCTCGCCGCCGGCTCTTACTATCACGGCGACCCCGTTGCCATGTTCAGCATGTTGGCTGCC
TGGCGCTTCTTCGTCGGCATCGGTATTGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGC
GAGCTGCGTAGCGGGACGCGGAACCGATGGTTCATCCTCTTTACCAATAGCATGATTGACTGGGGCTTCGTCTTT
GGCGCCTTTATCCCTTACGTCATCGCCGCGGCTGCCCAGAACCGCAACTACTCGACTATTTGGCGCACCAGCCTC
GGCATCGGCGTCGTCTTCCCTCTCGCCATGCTGCTTATGCGCATGCGCCTCAAGGAGCCCGAAGAGTTTGCCCGC
GAGTCGATGCGGCGCAAGACGCCTTATCTGCTGGTGCTGCGCTACTACTGGTTCCGGCTGTTTTGCGTCAGCCTC
GTCTGGTTCCTCTACGATTTCAGCACATACGCCTTTGGCATCTACGTCTCGTCGATCCTCAGCGCCATCTACGGC
GACAACGCCTCCCTCACCACCGTCTTCGGCTGGAGTACCGTCATCAACACCTTCTACCTGCCCGGCACCTTGATC
GGCGCCCTCGTCAGCGATTGGCTGGGCCCCAAGTACACGCTGATCGGGGGCGTCACCATCCAGGCCATCGTGGGC
TTCATCATGGCCGCCGTCTACGACCGCATCTCACACAATGTGGCTGCCTTCGCCGTCACCTATGGCCTCTTCCTC
ACCCTGGGCGAGCTGGGTCCGGGCAACAACATCGGTTTACTGGCAGCCAAGACGTGCGCGACGGGCGTCCGCGGC
CGCTACTATGGCATCTCCGCCGCCATCGGCAAGATCGGGGCCTTTGTCGGCTCCTACGTGTTCCCTTACATCCAG
GCCGCCGGCGGCGCCCCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTCTGCATCCTG
TCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAGTTCCGTGCC
TATCTCGAGGCCAAGGGGTGGGACACGTCGCTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTGACGTATGCC
GAGGACGAGCATCAGCGGCAGGAGCCCATGAAGCAGTAG
Transcript >Ophun1|3407
ATGGCCATCTTCAGCCGCTTCATTGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGAGCGAAACTCCC
CAAGTCCGAGACGATGCCCTTGTCGAGGCTCAGGTCGATCAAAGGTCCTTTCTTCACAAGGCCATGCCCGTCTTC
GCCTGCGGAGCTGGTCTCTTCTCCGACGGTTACATCAATAATGTCATCGGCTCCGTCAACACGGTCCTCCGGCTC
CAATACGGCGACGTATACAAAAAGTCGACAGCAGCCTCCAACGTACCCGCCATTGCCTTTGCCGGCACCGTCGTC
GGTCAGCTCGTCTTCGGCTTCGCCTCGGATCGATGGTCTCGCTCCAACTCGTTGATGACGTCGACCGTCATTCTC
ATCATCTTTACAGCCCTCGCCGCCGGCTCTTACTATCACGGCGACCCCGTTGCCATGTTCAGCATGTTGGCTGCC
TGGCGCTTCTTCGTCGGCATCGGTATTGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGC
GAGCTGCGTAGCGGGACGCGGAACCGATGGTTCATCCTCTTTACCAATAGCATGATTGACTGGGGCTTCGTCTTT
GGCGCCTTTATCCCTTACGTCATCGCCGCGGCTGCCCAGAACCGCAACTACTCGACTATTTGGCGCACCAGCCTC
GGCATCGGCGTCGTCTTCCCTCTCGCCATGCTGCTTATGCGCATGCGCCTCAAGGAGCCCGAAGAGTTTGCCCGC
GAGTCGATGCGGCGCAAGACGCCTTATCTGCTGGTGCTGCGCTACTACTGGTTCCGGCTGTTTTGCGTCAGCCTC
GTCTGGTTCCTCTACGATTTCAGCACATACGCCTTTGGCATCTACGTCTCGTCGATCCTCAGCGCCATCTACGGC
GACAACGCCTCCCTCACCACCGTCTTCGGCTGGAGTACCGTCATCAACACCTTCTACCTGCCCGGCACCTTGATC
GGCGCCCTCGTCAGCGATTGGCTGGGCCCCAAGTACACGCTGATCGGGGGCGTCACCATCCAGGCCATCGTGGGC
TTCATCATGGCCGCCGTCTACGACCGCATCTCACACAATGTGGCTGCCTTCGCCGTCACCTATGGCCTCTTCCTC
ACCCTGGGCGAGCTGGGTCCGGGCAACAACATCGGTTTACTGGCAGCCAAGACGTGCGCGACGGGCGTCCGCGGC
CGCTACTATGGCATCTCCGCCGCCATCGGCAAGATCGGGGCCTTTGTCGGCTCCTACGTGTTCCCTTACATCCAG
GCCGCCGGCGGCGCCCCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTCTGCATCCTG
TCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAGTTCCGTGCC
TATCTCGAGGCCAAGGGGTGGGACACGTCGCTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTGACGTATGCC
GAGGACGAGCATCAGCGGCAGGAGCCCATGAAGCAGTAG
Gene >Ophun1|3407
ATGGCCATCTTCAGCCGCTTCATTGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGAGCGAAACTCCC
CAAGTCCGAGACGATGCCCTTGTCGAGGCTCAGGTCGATCAAAGGTCCTTTCTTCACAAGGCCATGCCCGTCTTC
GCCTGCGGAGCTGGTCTCTTCTCCGACGGTTACATCAATAATGTGAGTCTCCTCTCTTCGTCATCAGGAAACAAA
AGCACTAAACATGGCCCAGGTCATCGGCTCCGTCAACACGGTCCTCCGGCTCCAATACGGCGACGTATACAAAAA
GTCGACAGCAGCCTCCAACGTACCCGCCATTGCCTTTGCCGGCACCGTCGTCGGTCAGCTCGTCTTCGGCTTCGC
CTCGGATCGATGGTCTCGCTCCAACTCGTTGATGACGTCGACCGTCATTCTCATCATCTTTACAGCCCTCGCCGC
CGGCTCTTACTATCACGGCGACCCCGTTGCCATGTTCAGCATGTTGGCTGCCTGGCGCTTCTTCGTCGGCATCGG
TATTGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGCGAGCTGCGTAGCGGGACGCGGAA
CCGATGGTTCATCCTCTTTACCAATAGCATGATTGACTGGGGCTTCGTCTTTGGCGCCTTTATCCCTTGTGAGTC
CCAGTCCTGCACTCGTCTCTTCCGTCGTCTTACTGACGTCTGTAGACGTCATCGCCGCGGCTGCCCAGAACCGCA
ACTACTCGACTATTTGGCGCACCAGCCTCGGCATCGGCGTCGTCTTCCCTCTCGCCATGCTGCTTATGCGCATGC
GCCTCAAGGAGCCCGAAGAGTTTGCCCGCGAGTCGATGCGGCGCAAGACGCCTTATCTGCTGGTGCTGCGCTACT
ACTGGTTCCGGCTGTTTTGCGTCAGCCTCGTCTGGTTCCTCTACGATGTGAGCTTCTTCTTTCTCCCCAGGTAGA
AAGGCTCGACGTCTCACCCCTACAAAGTTCAGCACATACGCCTTTGGCATCTACGTCTCGTCGATCCTCAGCGCC
ATCTACGGCGACAACGCCTCCCTCACCACCGTCTTCGGCTGGAGTACCGTCATCAACACCTTCTACCTGCCCGGC
ACCTTGATCGGCGCCCTCGTCAGCGATTGGCTGGGCCCCAAGTACACGCTGATCGGGGGCGTCACCATCCAGGCC
ATCGTGGGCTTCATCATGGCCGCCGTCTACGACCGCATCTCACACAATGTGGCTGCCTTCGCCGTCACCTATGGC
CTCTTCCTCACCCTGGGCGAGCTGGGTCCGGGCAACAACATCGGTTTACTGGCAGCCAAGACGTGCGCGACGGGC
GTCCGCGGCCGCTACTATGGCATCTCCGCCGCCATCGGCAAGATCGGGGCCTTTGTCGGCTCCTACGTGTTCCCT
TACATCCAGGCCGCCGGCGGCGCCCCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTC
TGCATCCTGTCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAG
TTCCGTGCCTATCTCGAGGCCAAGGGGTGGGACACGTCGCTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTG
ACGTATGCCGAGGACGAGCATCAGCGGCAGGAGCCCATGAAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail