Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3402
Gene name
LocationContig_300:2609..3680
Strand-
Gene length (bp)1071
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03006 HlyIII Haemolysin-III related 6.8E-66 74 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 38 312 6.0E-76
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 11 308 2.0E-70
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 22 302 2.0E-68
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 42 318 4.0E-67
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 42 318 6.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 38 312 6.0E-76
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 11 308 2.0E-70
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 22 302 2.0E-68
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 42 318 4.0E-67
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 42 318 6.0E-67
sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 41 312 2.0E-64
sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus GN=Adipor1 PE=1 SV=1 41 312 2.0E-64
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 38 302 9.0E-57
sp|Q03419|IZH1_YEAST ADIPOR-like receptor IZH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH1 PE=1 SV=1 9 309 8.0E-52
sp|Q753H5|IZH1_ASHGO ADIPOR-like receptor IZH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH1 PE=3 SV=1 9 297 7.0E-50
sp|Q93ZH9|HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana GN=HHP1 PE=1 SV=1 11 297 4.0E-42
sp|Q9ZUH8|HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana GN=HHP3 PE=2 SV=2 12 296 1.0E-36
sp|Q10PI5|ADPO3_ORYSJ Heptahelical transmembrane protein ADIPOR3 OS=Oryza sativa subsp. japonica GN=ADIPOR3 PE=2 SV=1 102 297 2.0E-35
sp|Q9SZG0|HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana GN=HHP4 PE=2 SV=1 118 297 4.0E-35
sp|Q6ETK9|ADPO2_ORYSJ Heptahelical transmembrane protein ADIPOR2 OS=Oryza sativa subsp. japonica GN=ADIPOR2 PE=2 SV=1 121 297 5.0E-35
sp|Q84N34|HHP2_ARATH Heptahelical transmembrane protein 2 OS=Arabidopsis thaliana GN=HHP2 PE=2 SV=1 12 296 3.0E-34
sp|A8WZU4|ADRL_CAEBR Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis briggsae GN=paqr-1 PE=3 SV=2 38 302 5.0E-34
sp|Q9SVF3|HPP5_ARATH Heptahelical transmembrane protein 5 OS=Arabidopsis thaliana GN=HHP5 PE=2 SV=1 118 297 2.0E-33
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 12 311 2.0E-30
sp|B7F9G7|ADPO1_ORYSJ Heptahelical transmembrane protein ADIPOR1 OS=Oryza sativa subsp. japonica GN=ADIPOR1 PE=2 SV=1 118 290 9.0E-26
sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family member 3 OS=Homo sapiens GN=PAQR3 PE=1 SV=2 38 291 1.0E-25
sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family member 3 OS=Mus musculus GN=Paqr3 PE=2 SV=1 38 291 2.0E-25
sp|Q75F81|IZH3_ASHGO ADIPOR-like receptor IZH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH3 PE=3 SV=1 43 269 3.0E-16
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 43 269 5.0E-16
sp|Q801G2|MPRAB_DANRE Membrane progestin receptor alpha-B OS=Danio rerio GN=paqr7b PE=1 SV=1 47 296 4.0E-13
sp|Q801D8|MPRA_CYNNE Membrane progestin receptor alpha OS=Cynoscion nebulosus GN=mpra PE=1 SV=1 47 304 6.0E-12
sp|Q6ZVX9|PAQR9_HUMAN Progestin and adipoQ receptor family member 9 OS=Homo sapiens GN=PAQR9 PE=2 SV=1 15 292 6.0E-12
sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 OS=Mus musculus GN=Paqr9 PE=1 SV=2 6 292 1.0E-11
sp|Q9NXK6|MPRG_HUMAN Membrane progestin receptor gamma OS=Homo sapiens GN=PAQR5 PE=1 SV=2 42 292 4.0E-11
sp|Q9JJE4|PAQR4_MOUSE Progestin and adipoQ receptor family member 4 OS=Mus musculus GN=Paqr4 PE=2 SV=1 38 288 8.0E-11
sp|Q8N4S7|PAQR4_HUMAN Progestin and adipoQ receptor family member 4 OS=Homo sapiens GN=PAQR4 PE=2 SV=3 38 288 4.0E-10
sp|Q6TCH4|PAQR6_HUMAN Progestin and adipoQ receptor family member 6 OS=Homo sapiens GN=PAQR6 PE=2 SV=2 54 297 2.0E-09
sp|Q9DCU0|MPRG_MOUSE Membrane progestin receptor gamma OS=Mus musculus GN=Paqr5 PE=2 SV=1 42 292 3.0E-09
sp|Q6TCG5|PAQR6_MOUSE Progestin and adipoQ receptor family member 6 OS=Mus musculus GN=Paqr6 PE=2 SV=1 54 297 4.0E-09
sp|Q6DC77|MPRGB_DANRE Membrane progestin receptor gamma-B OS=Danio rerio GN=paqr5b PE=2 SV=1 54 305 5.0E-09
sp|Q9SZG0|HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana GN=HHP4 PE=2 SV=1 38 98 2.0E-08
sp|Q9SVF3|HPP5_ARATH Heptahelical transmembrane protein 5 OS=Arabidopsis thaliana GN=HHP5 PE=2 SV=1 38 98 2.0E-08
sp|Q865K9|MPRB_PIG Membrane progestin receptor beta OS=Sus scrofa GN=PAQR8 PE=2 SV=1 43 309 4.0E-08
sp|Q80ZE5|MPRB_MOUSE Membrane progestin receptor beta OS=Mus musculus GN=Paqr8 PE=2 SV=2 43 314 1.0E-07
sp|Q80ZE4|MPRA_MOUSE Membrane progestin receptor alpha OS=Mus musculus GN=Paqr7 PE=2 SV=2 51 302 2.0E-07
sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha OS=Homo sapiens GN=PAQR7 PE=2 SV=1 18 305 3.0E-07
sp|Q865K8|MPRA_PIG Membrane progestin receptor alpha OS=Sus scrofa GN=PAQR7 PE=2 SV=1 51 305 3.0E-06
sp|Q8TEZ7|MPRB_HUMAN Membrane progestin receptor beta OS=Homo sapiens GN=PAQR8 PE=2 SV=1 43 296 4.0E-06
sp|Q10PI5|ADPO3_ORYSJ Heptahelical transmembrane protein ADIPOR3 OS=Oryza sativa subsp. japonica GN=ADIPOR3 PE=2 SV=1 38 98 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 115 137 22
3 152 174 22
4 179 201 22
5 211 233 22
6 245 267 22
7 282 304 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3402
MSSPASGPIPRQRRRRSSQSTAHDALSSVKHTAKQSLLLLWDELPAWRRDNAYIVSGYRHSNPSLTHVLCSLTTL
HNESVNIWSHLVGALLALATGLYLYCVVHPRYRYATPRDVFVFGCFFAGAAVCLGMSATYHTILHHSEPVARWGN
KLDYTGIVFLIVGSFVPALYYGFYCHPTLLTSYLSAICLLGVACTAVSWLERFRTPQWRPYRTAIFVALGLSSVF
PVVHGIALNGYRELQESMSIDWTIAQGVLYIAGALLYAVRWPERSLPGTFDIWGSSHQIFHMFVLMAAVTHFCGL
AKAFDHHHAMAGSRCQAR*
Coding >Ophun1|3402
ATGTCTTCACCCGCCTCCGGACCCATCCCTCGCCAACGCCGCCGCCGCTCCTCTCAATCCACCGCCCACGACGCC
CTCAGCAGCGTCAAGCACACGGCAAAACAGTCCCTCCTCCTCCTCTGGGACGAGCTCCCTGCCTGGCGCCGCGAC
AATGCCTACATCGTCTCGGGCTACCGCCATAGCAATCCCTCGCTGACGCACGTCCTCTGTTCCCTGACGACGCTA
CACAACGAGTCGGTCAACATCTGGTCGCACCTCGTCGGCGCCCTGCTGGCTCTCGCCACCGGCCTCTACCTCTAC
TGCGTTGTCCATCCCCGTTATCGCTATGCTACGCCCCGTGACGTCTTCGTCTTCGGCTGCTTCTTCGCCGGCGCC
GCTGTCTGCCTCGGCATGAGCGCCACCTATCACACTATCCTTCACCACAGCGAGCCCGTCGCCCGTTGGGGCAAC
AAACTCGATTACACCGGAATCGTCTTCCTCATCGTCGGGAGCTTCGTTCCGGCTCTGTATTATGGCTTCTACTGC
CACCCGACCCTACTGACGAGCTACCTGTCGGCCATATGCCTTCTCGGCGTCGCCTGTACCGCCGTCTCCTGGCTC
GAACGCTTTCGTACCCCCCAGTGGCGTCCCTATCGCACCGCCATATTCGTCGCCCTCGGCCTCTCTAGCGTCTTT
CCCGTGGTGCACGGAATTGCCTTGAACGGCTACCGCGAGCTGCAGGAGAGCATGAGTATCGATTGGACCATCGCC
CAAGGTGTGCTCTACATCGCCGGCGCCCTTCTCTATGCTGTTCGATGGCCTGAAAGGAGCCTCCCTGGAACCTTT
GACATCTGGGGCAGCTCTCACCAGATCTTTCACATGTTTGTCCTCATGGCCGCCGTAACCCACTTCTGCGGCCTG
GCCAAGGCCTTTGATCATCATCACGCCATGGCAGGATCTCGGTGTCAGGCCCGGTGA
Transcript >Ophun1|3402
ATGTCTTCACCCGCCTCCGGACCCATCCCTCGCCAACGCCGCCGCCGCTCCTCTCAATCCACCGCCCACGACGCC
CTCAGCAGCGTCAAGCACACGGCAAAACAGTCCCTCCTCCTCCTCTGGGACGAGCTCCCTGCCTGGCGCCGCGAC
AATGCCTACATCGTCTCGGGCTACCGCCATAGCAATCCCTCGCTGACGCACGTCCTCTGTTCCCTGACGACGCTA
CACAACGAGTCGGTCAACATCTGGTCGCACCTCGTCGGCGCCCTGCTGGCTCTCGCCACCGGCCTCTACCTCTAC
TGCGTTGTCCATCCCCGTTATCGCTATGCTACGCCCCGTGACGTCTTCGTCTTCGGCTGCTTCTTCGCCGGCGCC
GCTGTCTGCCTCGGCATGAGCGCCACCTATCACACTATCCTTCACCACAGCGAGCCCGTCGCCCGTTGGGGCAAC
AAACTCGATTACACCGGAATCGTCTTCCTCATCGTCGGGAGCTTCGTTCCGGCTCTGTATTATGGCTTCTACTGC
CACCCGACCCTACTGACGAGCTACCTGTCGGCCATATGCCTTCTCGGCGTCGCCTGTACCGCCGTCTCCTGGCTC
GAACGCTTTCGTACCCCCCAGTGGCGTCCCTATCGCACCGCCATATTCGTCGCCCTCGGCCTCTCTAGCGTCTTT
CCCGTGGTGCACGGAATTGCCTTGAACGGCTACCGCGAGCTGCAGGAGAGCATGAGTATCGATTGGACCATCGCC
CAAGGTGTGCTCTACATCGCCGGCGCCCTTCTCTATGCTGTTCGATGGCCTGAAAGGAGCCTCCCTGGAACCTTT
GACATCTGGGGCAGCTCTCACCAGATCTTTCACATGTTTGTCCTCATGGCCGCCGTAACCCACTTCTGCGGCCTG
GCCAAGGCCTTTGATCATCATCACGCCATGGCAGGATCTCGGTGTCAGGCCCGGTGA
Gene >Ophun1|3402
ATGTCTTCACCCGCCTCCGGACCCATCCCTCGCCAACGCCGCCGCCGCTCCTCTCAATCCACCGCCCACGACGCC
CTCAGCAGCGTCAAGCACACGGCAAAACAGTCCCTCCTCCTCCTCTGGGACGAGCTCCCTGCCTGGCGCCGCGAC
AATGCCTACATCGTCTCGGGCTACCGCCATAGCAATCCCTCGCTGACGCACGTCCTCTGTTCCCTGACGACGCTA
CACAACGAGTCGGTCAACATCTGGTCGCACCTCGTCGGCGCCCTGCTGGCTCTCGCCACCGGCCTCTACCTCTAC
TGCGTTGTCCATCCCCGTTATCGCTATGCTACGCCCCGTGACGTCTTCGTCTTCGGCTGCTTCTTCGCCGGCGCC
GCTGTCTGCCTCGGCATGAGCGCCACCTATCACACTATCCTTCACCACAGCGAGCCCGTCGCCCGTTGGGGCAAC
AAACTCGATTACACCGGAATCGTCTTCCTCATCGTCGGGAGCTTCGTTCCGGCTCTGTATTATGGCTTCTACTGC
CACCCGACCCTACTGACGAGCTACCTGTCGGCCGTACGTCTCCTTTCCTGTCGAGTCTCATCCTCTTCTAACTCG
GGGCATGCCGTCGCCAGATATGCCTTCTCGGCGTCGCCTGTACCGCCGTCTCCTGGCTCGAACGCTTTCGTACCC
CCCAGTGGCGTCCCTATCGCACCGCCATATTCGTCGCCCTCGGCCTCTCTAGCGTCTTTCCCGTGGTGCACGGAA
TTGCCTTGAACGGCTACCGCGAGCTGCAGGAGAGCATGAGTATCGATTGGACCATCGCCCAAGGTGTGCTCTACA
TCGCCGGCGCCCTTCTCTATGCTGTAAGGGACTGCAAATCGCCCCTTCTCGGTCTGTTAGCTGAACCGAGAACAA
AAGGTTCGATGGCCTGAAAGGAGCCTCCCTGGAACCTTTGACATCTGGGGCAGCTCTCACCAGATCTTTCACATG
TTTGTCCTCATGGCCGCCGTAACCCACTTCTGCGGCCTGGCCAAGGCCTTTGATCATCATCACGCCATGGCAGGA
TCTCGGTGTCAGGCCCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail