Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3397
Gene name
LocationContig_30:52617..53382
Strand+
Gene length (bp)765
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.9E-18 123 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 39 248 2.0E-25
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 39 248 7.0E-25
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 6 254 4.0E-22
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 2 227 6.0E-19
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 6 254 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 39 248 2.0E-25
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 39 248 7.0E-25
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 6 254 4.0E-22
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 2 227 6.0E-19
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 6 254 2.0E-18
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 12 235 1.0E-17
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 1 253 2.0E-17
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 2 227 2.0E-17
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 12 226 2.0E-16
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 12 226 5.0E-16
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 12 226 8.0E-16
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 12 226 8.0E-16
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 12 226 8.0E-16
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 12 226 1.0E-15
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 101 253 1.0E-15
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 1 253 1.0E-15
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 12 226 1.0E-15
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 4 226 4.0E-15
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 39 235 2.0E-14
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 59 226 1.0E-13
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 2 234 9.0E-13
sp|A8WGT1|C25L2_DANRE Cholesterol 25-hydroxylase-like protein 2 OS=Danio rerio GN=ch25hl2 PE=2 SV=1 6 248 9.0E-09
sp|Q9EQS5|SC5D_RAT Lathosterol oxidase OS=Rattus norvegicus GN=Sc5d PE=1 SV=1 130 239 2.0E-07
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 127 239 3.0E-07
sp|O88822|SC5D_MOUSE Lathosterol oxidase OS=Mus musculus GN=Sc5d PE=2 SV=2 130 239 4.0E-07
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 8 236 2.0E-06
sp|O75845|SC5D_HUMAN Lathosterol oxidase OS=Homo sapiens GN=SC5D PE=1 SV=2 130 239 3.0E-06
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 26 239 5.0E-06
sp|O93875|ERG3_CANAX Delta(7)-sterol 5(6)-desaturase OS=Candida albicans GN=ERG3 PE=3 SV=1 26 239 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005506 iron ion binding Yes
GO:0008610 lipid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 76 93 17
3 190 212 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3397
MSTRLSSLEGFWFYLLANYDPFSIKIFGLVMVDVVAWWIPCFVFASLEYMAPSFAARHKMQATEKSPTLRKLCRC
IMVALANTSLGAVQYTALNHLFSTKAYPAGNRFDARLPSFSRFAGEFLMSFALREILFYWGHRALHWRPLYKSIH
RIHHEFSAPVAFASKYAHPVEFLTSDALPIMLPPFLLRTHMVSTFAFTAGTLFTSTVIHSGYDFFYRAAWMHDRH
HEGANAYFGAFGALGLIDWAHGTVEKDRR*
Coding >Ophun1|3397
ATGAGCACGAGATTATCATCACTGGAGGGCTTCTGGTTCTACCTCCTGGCCAACTACGACCCCTTCTCCATCAAG
ATCTTCGGCCTCGTCATGGTCGATGTCGTCGCTTGGTGGATTCCCTGCTTCGTCTTCGCCTCGCTCGAGTACATG
GCGCCTTCATTCGCGGCGAGACACAAGATGCAAGCAACAGAGAAGAGCCCTACCTTGAGAAAGTTGTGCCGCTGC
ATCATGGTGGCTTTGGCCAACACGTCGCTCGGCGCCGTACAATATACAGCCCTGAACCACCTGTTTTCCACAAAG
GCTTATCCCGCGGGCAATCGGTTCGACGCGAGGTTGCCGTCTTTCAGCCGCTTCGCGGGAGAGTTCCTCATGAGC
TTCGCCCTGCGCGAGATCTTGTTCTACTGGGGTCACCGGGCTCTTCACTGGCGGCCGCTGTACAAGAGCATTCAC
AGGATACACCACGAGTTTTCAGCGCCCGTGGCCTTTGCGTCCAAGTACGCTCATCCGGTCGAGTTTCTGACGTCG
GATGCGCTGCCCATCATGCTGCCGCCTTTTCTACTGCGGACGCACATGGTTTCGACGTTTGCTTTTACGGCTGGC
ACGCTTTTCACGTCGACTGTTATTCATAGCGGCTACGACTTCTTTTATAGGGCGGCGTGGATGCATGATCGGCAT
CATGAGGGGGCCAATGCTTACTTTGGGGCGTTTGGTGCTTTGGGCCTGATTGATTGGGCTCATGGGACTGTTGAG
AAGGATCGCAGGTGA
Transcript >Ophun1|3397
ATGAGCACGAGATTATCATCACTGGAGGGCTTCTGGTTCTACCTCCTGGCCAACTACGACCCCTTCTCCATCAAG
ATCTTCGGCCTCGTCATGGTCGATGTCGTCGCTTGGTGGATTCCCTGCTTCGTCTTCGCCTCGCTCGAGTACATG
GCGCCTTCATTCGCGGCGAGACACAAGATGCAAGCAACAGAGAAGAGCCCTACCTTGAGAAAGTTGTGCCGCTGC
ATCATGGTGGCTTTGGCCAACACGTCGCTCGGCGCCGTACAATATACAGCCCTGAACCACCTGTTTTCCACAAAG
GCTTATCCCGCGGGCAATCGGTTCGACGCGAGGTTGCCGTCTTTCAGCCGCTTCGCGGGAGAGTTCCTCATGAGC
TTCGCCCTGCGCGAGATCTTGTTCTACTGGGGTCACCGGGCTCTTCACTGGCGGCCGCTGTACAAGAGCATTCAC
AGGATACACCACGAGTTTTCAGCGCCCGTGGCCTTTGCGTCCAAGTACGCTCATCCGGTCGAGTTTCTGACGTCG
GATGCGCTGCCCATCATGCTGCCGCCTTTTCTACTGCGGACGCACATGGTTTCGACGTTTGCTTTTACGGCTGGC
ACGCTTTTCACGTCGACTGTTATTCATAGCGGCTACGACTTCTTTTATAGGGCGGCGTGGATGCATGATCGGCAT
CATGAGGGGGCCAATGCTTACTTTGGGGCGTTTGGTGCTTTGGGCCTGATTGATTGGGCTCATGGGACTGTTGAG
AAGGATCGCAGGTGA
Gene >Ophun1|3397
ATGAGCACGAGATTATCATCACTGGAGGGCTTCTGGTTCTACCTCCTGGCCAACTACGACCCCTTCTCCATCAAG
ATCTTCGGCCTCGTCATGGTCGATGTCGTCGCTTGGTGGATTCCCTGCTTCGTCTTCGCCTCGCTCGAGTACATG
GCGCCTTCATTCGCGGCGAGACACAAGATGCAAGCAACAGAGAAGAGCCCTACCTTGAGAAAGTTGTGCCGCTGC
ATCATGGTGGCTTTGGCCAACACGTCGCTCGGCGCCGTACAATATACAGCCCTGAACCACCTGTTTTCCACAAAG
GCTTATCCCGCGGGCAATCGGTTCGACGCGAGGTTGCCGTCTTTCAGCCGCTTCGCGGGAGAGTTCCTCATGAGC
TTCGCCCTGCGCGAGATCTTGTTCTACTGGGGTCACCGGGCTCTTCACTGGCGGCCGCTGTACAAGAGCATTCAC
AGGATACACCACGAGTTTTCAGCGCCCGTGGCCTTTGCGTCCAAGTACGCTCATCCGGTCGAGTTTCTGACGTCG
GATGCGCTGCCCATCATGCTGCCGCCTTTTCTACTGCGGACGCACATGGTTTCGACGTTTGCTTTTACGGCTGGC
ACGCTTTTCACGTCGACTGTTATTCATAGCGGCTACGACTTCTTTTATAGGGCGGCGTGGATGCATGATCGGCAT
CATGAGGGGGCCAATGCTTACTTTGGGGCGTTTGGTGCTTTGGGCCTGATTGATTGGGCTCATGGGACTGTTGAG
AAGGATCGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail