Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3390
Gene name
LocationContig_30:37759..39395
Strand-
Gene length (bp)1636
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.5E-29 50 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 36 522 7.0E-57
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 33 463 3.0E-55
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 30 438 6.0E-54
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 34 520 6.0E-53
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 28 520 6.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 36 522 7.0E-57
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 33 463 3.0E-55
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 30 438 6.0E-54
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 34 520 6.0E-53
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 28 520 6.0E-47
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 26 520 3.0E-45
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 17 486 1.0E-35
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 28 520 9.0E-35
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 28 520 6.0E-32
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 16 434 1.0E-31
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 19 522 2.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 20 433 3.0E-31
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 20 481 1.0E-30
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 29 520 8.0E-21
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 33 450 3.0E-14
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 25 465 4.0E-13
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 34 277 6.0E-13
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 29 274 7.0E-08
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 33 450 1.0E-07
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 30 256 2.0E-07
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 29 256 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 136 158 22
3 171 193 22
4 203 225 22
5 274 296 22
6 311 330 19
7 337 359 22
8 369 391 22
9 404 421 17
10 436 458 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3390
MAGSVKPAVSHTSGPGPGPSPGTPPRIPLSDAQDRQICRKTDRVILSLLVWVYFLQILDKSVLAYGATYGLKHDT
RLVGNQYSLVSAAAPMAQLLWQPASSYLIVRVPHRVLMAGLVFGWGVAQAASAACRDFGGLMAARFFLGLFEAGC
LPLFGVITSQWYRRAEQPLRIAAWYGTNGLATMFASAVSFGLGQISSSALHPWQIIFLFVGLLTIVTAPFVYYRL
DNDIPSARFLDPYEKLQALERLRANQTGTGSRAFDLSHVTEAAREPKTYLWIAMTLLLNVGAAVTNTFGPLILDG
FVDDHRLTSLLNMPFGALQFIVILLASYLAQKASRKAVILASFMVPVVIGLAILYAIHRQNAPGSRAALLIGYYL
LAFLFGGNPLIVTWIIGNTAGTTKKSVIMGLYNAASAAGNIIGPLLFNDADAPAYKPGLRACLAIFVTLVVVVLV
QWANLVALNKTQEMRRVRNGKPAKVVDLSMQRHFHVAQHDADMDDTSSEPYQVDAAHSDLTDGRNDEFVYIY*
Coding >Ophun1|3390
ATGGCCGGCTCCGTCAAGCCCGCCGTGTCACACACCTCCGGCCCCGGCCCCGGCCCCTCCCCCGGAACCCCCCCC
CGAATCCCCCTCAGCGACGCCCAAGACCGGCAAATCTGCCGCAAAACGGACCGCGTCATCCTCTCCCTCCTGGTA
TGGGTCTACTTCCTGCAAATCCTCGACAAGTCCGTCCTCGCCTACGGCGCAACCTACGGCCTCAAGCACGACACC
CGCCTGGTGGGAAACCAGTACTCGCTCGTCAGCGCCGCCGCGCCCATGGCCCAGCTTCTGTGGCAGCCCGCGTCG
AGTTACCTCATCGTCCGCGTGCCGCATCGCGTCTTGATGGCTGGCTTGGTGTTCGGCTGGGGGGTTGCGCAGGCG
GCTTCGGCGGCGTGTAGGGATTTTGGGGGGTTGATGGCTGCGCGCTTCTTTCTTGGCTTGTTTGAGGCTGGTTGT
TTGCCCTTGTTTGGTGTCATTACCAGTCAGTGGTATCGACGGGCTGAACAGCCGTTGAGGATAGCGGCTTGGTAT
GGAACCAACGGGCTGGCTACCATGTTTGCATCGGCTGTATCCTTTGGATTGGGTCAGATATCATCTTCAGCTCTA
CACCCTTGGCAGATAATCTTCCTCTTCGTCGGCCTCCTCACCATCGTCACCGCCCCCTTCGTCTACTACCGTCTC
GACAACGACATCCCCTCAGCCCGCTTCCTCGATCCCTACGAGAAGCTCCAGGCCTTGGAACGACTCCGCGCAAAC
CAAACCGGCACCGGATCCCGCGCCTTTGACCTCTCTCACGTCACTGAAGCAGCCCGCGAACCAAAGACTTACCTC
TGGATCGCCATGACGCTTCTCCTCAACGTCGGCGCCGCTGTCACAAACACTTTCGGTCCCCTCATCCTCGACGGC
TTCGTCGACGACCACCGTCTAACAAGCCTCCTCAACATGCCCTTTGGCGCCCTGCAATTCATCGTCATCCTGCTA
GCCAGCTACCTCGCTCAGAAAGCCAGCCGCAAAGCCGTCATCCTGGCCTCCTTCATGGTCCCCGTCGTCATCGGC
CTCGCCATTCTCTACGCAATCCATCGTCAAAACGCCCCTGGTTCCCGTGCCGCTCTCCTCATCGGCTACTACCTT
CTCGCCTTTCTCTTCGGCGGCAACCCGCTCATCGTAACCTGGATCATCGGCAACACAGCGGGCACCACCAAGAAA
TCCGTCATCATGGGCTTGTACAACGCCGCCAGCGCCGCCGGCAACATCATCGGCCCGCTGCTCTTCAACGACGCC
GACGCGCCGGCTTATAAGCCCGGTCTGCGCGCCTGTCTGGCCATCTTCGTGACCCTCGTCGTCGTCGTCTTGGTC
CAGTGGGCCAACCTGGTGGCTTTGAATAAGACGCAGGAGATGAGGCGCGTTCGCAACGGCAAGCCGGCCAAGGTG
GTTGATCTTTCTATGCAGCGGCATTTTCACGTCGCTCAGCATGATGCCGATATGGATGACACATCGTCGGAGCCT
TATCAGGTTGACGCTGCGCACTCGGACTTGACGGATGGTCGGAACGATGAGTTTGTCTACATATATTAA
Transcript >Ophun1|3390
ATGGCCGGCTCCGTCAAGCCCGCCGTGTCACACACCTCCGGCCCCGGCCCCGGCCCCTCCCCCGGAACCCCCCCC
CGAATCCCCCTCAGCGACGCCCAAGACCGGCAAATCTGCCGCAAAACGGACCGCGTCATCCTCTCCCTCCTGGTA
TGGGTCTACTTCCTGCAAATCCTCGACAAGTCCGTCCTCGCCTACGGCGCAACCTACGGCCTCAAGCACGACACC
CGCCTGGTGGGAAACCAGTACTCGCTCGTCAGCGCCGCCGCGCCCATGGCCCAGCTTCTGTGGCAGCCCGCGTCG
AGTTACCTCATCGTCCGCGTGCCGCATCGCGTCTTGATGGCTGGCTTGGTGTTCGGCTGGGGGGTTGCGCAGGCG
GCTTCGGCGGCGTGTAGGGATTTTGGGGGGTTGATGGCTGCGCGCTTCTTTCTTGGCTTGTTTGAGGCTGGTTGT
TTGCCCTTGTTTGGTGTCATTACCAGTCAGTGGTATCGACGGGCTGAACAGCCGTTGAGGATAGCGGCTTGGTAT
GGAACCAACGGGCTGGCTACCATGTTTGCATCGGCTGTATCCTTTGGATTGGGTCAGATATCATCTTCAGCTCTA
CACCCTTGGCAGATAATCTTCCTCTTCGTCGGCCTCCTCACCATCGTCACCGCCCCCTTCGTCTACTACCGTCTC
GACAACGACATCCCCTCAGCCCGCTTCCTCGATCCCTACGAGAAGCTCCAGGCCTTGGAACGACTCCGCGCAAAC
CAAACCGGCACCGGATCCCGCGCCTTTGACCTCTCTCACGTCACTGAAGCAGCCCGCGAACCAAAGACTTACCTC
TGGATCGCCATGACGCTTCTCCTCAACGTCGGCGCCGCTGTCACAAACACTTTCGGTCCCCTCATCCTCGACGGC
TTCGTCGACGACCACCGTCTAACAAGCCTCCTCAACATGCCCTTTGGCGCCCTGCAATTCATCGTCATCCTGCTA
GCCAGCTACCTCGCTCAGAAAGCCAGCCGCAAAGCCGTCATCCTGGCCTCCTTCATGGTCCCCGTCGTCATCGGC
CTCGCCATTCTCTACGCAATCCATCGTCAAAACGCCCCTGGTTCCCGTGCCGCTCTCCTCATCGGCTACTACCTT
CTCGCCTTTCTCTTCGGCGGCAACCCGCTCATCGTAACCTGGATCATCGGCAACACAGCGGGCACCACCAAGAAA
TCCGTCATCATGGGCTTGTACAACGCCGCCAGCGCCGCCGGCAACATCATCGGCCCGCTGCTCTTCAACGACGCC
GACGCGCCGGCTTATAAGCCCGGTCTGCGCGCCTGTCTGGCCATCTTCGTGACCCTCGTCGTCGTCGTCTTGGTC
CAGTGGGCCAACCTGGTGGCTTTGAATAAGACGCAGGAGATGAGGCGCGTTCGCAACGGCAAGCCGGCCAAGGTG
GTTGATCTTTCTATGCAGCGGCATTTTCACGTCGCTCAGCATGATGCCGATATGGATGACACATCGTCGGAGCCT
TATCAGGTTGACGCTGCGCACTCGGACTTGACGGATGGTCGGAACGATGAGTTTGTCTACATATATTAA
Gene >Ophun1|3390
ATGGCCGGCTCCGTCAAGCCCGCCGTGTCACACACCTCCGGCCCCGGCCCCGGCCCCTCCCCCGGAACCCCCCCC
CGAATCCCCCTCAGCGACGCCCAAGACCGGCAAATCTGCCGCAAAACGGACCGCGTCATCCTCTCCCTCCTGGTA
TGGGTCTACTTCCTGCAAATCCTCGACAAGTCCGTCCTCGCCTACGGCGCAACCTACGGCCTCAAGCACGACACC
CGCCTGGTGGGAAACCAGTACTCGCTCGTCAGCGCCGCCGCGCCCATGGCCCAGCTTCTGTGGCAGCCCGCGTCG
AGTTACCTCATCGTCCGCGTGCCGCATCGCGTCTTGATGGCTGGCTTGGTGTTCGGCTGGGGGGTTGCGCAGGCG
GCTTCGGCGGCGTGTAGGGATTTTGGGGGGTTGATGGCTGCGCGCTTCTTTCTTGGCTTGTTTGAGGCTGGTTGT
TTGCCCTTGTTTGGTGTCATTACCAGTCAGTGGTATCGACGGGCTGAACAGCCGTTGAGGATAGCGGCTTGGTAT
GGAACCAACGGGCTGGCTACCATGTTTGCATCGGCTGTATCCTTTGGATTGGGTCAGATATCATCTTCAGCTCTA
CACCCTTGGCAGATGTACGTTCTCTTCTCTCTTTCTTTCTTCCTCCCTTCATCCTAAGGACTAACCAACTAACCA
TGCTAGAATCTTCCTCTTCGTCGGCCTCCTCACCATCGTCACCGCCCCCTTCGTCTACTACCGTCTCGACAACGA
CATCCCCTCAGCCCGCTTCCTCGATCCCTACGAGAAGCTCCAGGCCTTGGAACGACTCCGCGCAAACCAAACCGG
CACCGGATCCCGCGCCTTTGACCTCTCTCACGTCACTGAAGCAGCCCGCGAACCAAAGACTTACCTCTGGATCGC
CATGACGCTTCTCCTCAACGTCGGCGCCGCTGTCACAAACACTTTCGGTCCCCTCATCCTCGACGGCTTCGTCGA
CGACCACCGTCTAACAAGCCTCCTCAACATGCCCTTTGGCGCCCTGCAATTCATCGTCATCCTGCTAGCCAGCTA
CCTCGCTCAGAAAGCCAGCCGCAAAGCCGTCATCCTGGCCTCCTTCATGGTCCCCGTCGTCATCGGCCTCGCCAT
TCTCTACGCAATCCATCGTCAAAACGCCCCTGGTTCCCGTGCCGCTCTCCTCATCGGCTACTACCTTCTCGCCTT
TCTCTTCGGCGGCAACCCGCTCATCGTAACCTGGATCATCGGCAACACAGCGGGCACCACCAAGAAATCCGTCAT
CATGGGCTTGTACAACGCCGCCAGCGCCGCCGGCAACATCATCGGCCCGCTGCTCTTCAACGACGCCGACGCGCC
GGCTTATAAGCCCGGTCTGCGCGCCTGTCTGGCCATCTTCGTGACCCTCGTCGTCGTCGTCTTGGTCCAGTGGGC
CAACCTGGTGGCTTTGAATAAGACGCAGGAGATGAGGCGCGTTCGCAACGGCAAGCCGGCCAAGGTGGTTGATCT
TTCTATGCAGCGGCATTTTCACGTCGCTCAGCATGATGCCGATATGGATGACACATCGTCGGAGCCTTATCAGGT
TGACGCTGCGCACTCGGACTTGACGGATGGTCGGAACGATGAGTTTGTCTACATATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail