Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3389
Gene name
LocationContig_30:35542..36951
Strand+
Gene length (bp)1409
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 5.5E-10 139 183
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.0E-08 140 182
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.1E-07 139 182
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.4E-07 139 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5RAK3|RN180_PONAB E3 ubiquitin-protein ligase RNF180 OS=Pongo abelii GN=RNF180 PE=2 SV=1 110 204 4.0E-07
sp|O60117|YH73_SCHPO Uncharacterized RING finger protein C16G5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.03 PE=3 SV=1 140 246 4.0E-07
sp|Q86T96|RN180_HUMAN E3 ubiquitin-protein ligase RNF180 OS=Homo sapiens GN=RNF180 PE=2 SV=2 114 204 3.0E-06

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|861
Ophiocordyceps australis map64 (Brazil) OphauB2|7608
Ophiocordyceps camponoti-floridani Ophcf2|00535
Ophiocordyceps camponoti-floridani Ophcf2|00536
Ophiocordyceps camponoti-rufipedis Ophun1|3389 (this protein)
Ophiocordyceps kimflemingae Ophio5|7640
Ophiocordyceps subramaniannii Hirsu2|789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3389
MELNDVILNTISPQLSREAVRCPSPREKIQQIRKSLHLNAVEEKRLARDKYEAIVRKKGRRNWTSWAMELEGAFM
DCEYLNVAGYNDAKAREDFIKCLCASSVPWVASCGVSFSVTHEMTKEEDRASLEDREASPTEIQCVICLETVSEP
CELRPCRHLTFHYPCIDRWLRSDGRRRSCPICKATVSSVAFGSEQNPQCREYFTGDSDSESEGEGEGESEDARRL
RRQTAQDELVGLDVRRHVYRRMLYSMHVGSNRYSGYQSGEGLFAP*
Coding >Ophun1|3389
ATGGAGTTAAACGACGTTATCCTGAACACAATCAGCCCGCAGCTCTCCCGTGAAGCAGTTAGGTGTCCAAGCCCG
CGCGAGAAAATCCAGCAGATCAGAAAGTCGCTCCATCTCAACGCCGTCGAAGAGAAGAGGCTGGCCAGGGACAAG
TACGAAGCCATCGTCAGGAAGAAGGGGCGTCGCAACTGGACCTCTTGGGCTATGGAACTGGAGGGAGCCTTTATG
GACTGCGAGTATCTCAACGTCGCCGGTTATAACGATGCAAAGGCACGGGAGGACTTTATCAAGTGTCTCTGCGCC
TCGTCGGTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCCGTCACGCACGAAATGACCAAGGAAGAAGACAGA
GCGAGTCTGGAGGACCGCGAAGCCTCACCGACGGAAATACAATGCGTCATATGCCTCGAAACCGTCAGCGAGCCC
TGTGAACTCCGGCCCTGCCGACACCTCACCTTTCACTACCCCTGCATCGACCGCTGGCTTCGCTCCGACGGGCGA
CGACGGTCTTGCCCCATCTGTAAGGCTACCGTCTCGAGCGTGGCGTTCGGATCGGAGCAGAATCCGCAGTGCCGC
GAGTACTTTACTGGTGACAGTGACAGTGAGAGCGAGGGCGAGGGCGAGGGCGAGAGCGAGGACGCACGGCGACTT
AGGAGACAGACTGCGCAGGACGAGCTGGTTGGTCTTGATGTTCGCCGCCATGTCTACCGTCGGATGTTGTACTCG
ATGCACGTTGGGTCCAACCGGTATTCCGGATACCAGTCGGGCGAGGGCCTTTTTGCGCCGTGA
Transcript >Ophun1|3389
ATGGAGTTAAACGACGTTATCCTGAACACAATCAGCCCGCAGCTCTCCCGTGAAGCAGTTAGGTGTCCAAGCCCG
CGCGAGAAAATCCAGCAGATCAGAAAGTCGCTCCATCTCAACGCCGTCGAAGAGAAGAGGCTGGCCAGGGACAAG
TACGAAGCCATCGTCAGGAAGAAGGGGCGTCGCAACTGGACCTCTTGGGCTATGGAACTGGAGGGAGCCTTTATG
GACTGCGAGTATCTCAACGTCGCCGGTTATAACGATGCAAAGGCACGGGAGGACTTTATCAAGTGTCTCTGCGCC
TCGTCGGTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCCGTCACGCACGAAATGACCAAGGAAGAAGACAGA
GCGAGTCTGGAGGACCGCGAAGCCTCACCGACGGAAATACAATGCGTCATATGCCTCGAAACCGTCAGCGAGCCC
TGTGAACTCCGGCCCTGCCGACACCTCACCTTTCACTACCCCTGCATCGACCGCTGGCTTCGCTCCGACGGGCGA
CGACGGTCTTGCCCCATCTGTAAGGCTACCGTCTCGAGCGTGGCGTTCGGATCGGAGCAGAATCCGCAGTGCCGC
GAGTACTTTACTGGTGACAGTGACAGTGAGAGCGAGGGCGAGGGCGAGGGCGAGAGCGAGGACGCACGGCGACTT
AGGAGACAGACTGCGCAGGACGAGCTGGTTGGTCTTGATGTTCGCCGCCATGTCTACCGTCGGATGTTGTACTCG
ATGCACGTTGGGTCCAACCGGTATTCCGGATACCAGTCGGGCGAGGGCCTTTTTGCGCCGTGA
Gene >Ophun1|3389
ATGGAGTTAAACGACGTTATCCTGAACACAATCAGCCCGCAGCTCTCCCGTGAAGCAGTTAGGTGTCCAAGCCCG
CGCGAGAAAATCCAGCAGATCAGAAAGTCGCTCCATCTCAACGCCGTCGAAGAGAAGAGGCTGGCCAGGGACAAG
TACGAAGCCATCGTCAGGAAGAAGGGGCGTCGCAACTGGACCTCTTGGGCTATGGAACTGGAGGGAGCCTTTATG
GACTGCGAGTATCTCAACGTCGCCGGTTATAACGATGCAAAGGCACGGGAGGACTTTATCAAGTGTCTCTGCGCC
TCGTCGGTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCCGTCACGCACGAAATGACCAAGGAAGAAGACAGA
GCGAGTCTGGAGGAGTATGTGAGGATCTTTCGGGTGACAGCCGAACGCCGGTTCCCAACTGTGGGATCTTAGCAG
GCGTCAGCTGGCTCGAGGGAGGCAGAAGCAGGGTTAAGGAGGTTAATGTGGCGATGATTGGGATGGCCCTTCGAT
TATCAGTCAGGTTTTGCTCTGGTAAGAGTGAATCTTCGGGTTATAATGGGATATGAGTCTTTGAACTTCATACAA
GGCCATCTGACGCGGCGTCGCGGATTTCCAGCGGGCTTCACGGGCTGGGAGTTGTTTCCTGGGTGGCACGTGATA
TTTGGAAGAATGATGACGATGACTAAGCAGAGCCTTTAACTTGGAGGTGAAGTCTTGGAGACGCGCAATGGAAAC
AACTTCCAGCCTCATCGAAGCCTCCCCTTCTGCCACTACTCTTTTTCAAGATACTATCATCGACACTACGAGAAG
CACGAATCTTCGAAGCACATCTCTTTGCCAAACTCCATCTTCGTCAGCCCTCGACTATCACGACGCATGTGTTCC
CAAACCCCAGCCCACGCTCCCCATCATCCCCTCGCACGCAGCCGCGAAGCCTCACCGACGGAAATACAATGCGTC
ATATGCCTCGAAACCGTCAGCGAGCCCTGTGAACTCCGGCCCTGCCGACACCTCACCTTTCACTACCCCTGCATC
GACCGCTGGCTTCGCTCCGACGGGCGACGACGGTCTTGCCCCATCTGTAAGGCTACCGTCTCGAGCGTGGCGTTC
GGATCGGAGCAGAATCCGCAGTGCCGCGAGTACTTTACTGGTGACAGTGACAGTGAGAGCGAGGGCGAGGGCGAG
GGCGAGAGCGAGGACGCACGGCGACTTAGGAGACAGACTGCGCAGGACGAGCTGGTTGGTCTTGATGTTCGCCGC
CATGTCTACCGTCGGATGTTGTACTCGATGCACGTTGGGTCCAACCGGTATTCCGGATACCGTGAGCTCTGCCCG
CTGGTGTTCCTCTCTGACGAGCGCTTACAGAGTCGGGCGAGGGCCTTTTTGCGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail