Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3388
Gene name
LocationContig_30:33524..34970
Strand+
Gene length (bp)1446
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 6.4E-19 135 264

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53693|RDS1_SCHPO Protein rds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rds1 PE=2 SV=2 96 481 1.0E-127

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999769

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5597
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4749
Ophiocordyceps camponoti-floridani Ophcf2|00537
Ophiocordyceps camponoti-rufipedis Ophun1|3388 (this protein)
Ophiocordyceps kimflemingae Ophio5|4674
Ophiocordyceps subramaniannii Hirsu2|7551

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3388
MPSNKLLGLWLTLLSCAHAAPAASSSLTGPFPSSPSGLPPFPFPFSIPSQPQPSVVSYTDVTSHGPYTGPSATTT
GALSTSVLSPSISALPPPPGSYDYPADGLLHANQPAPFTPSGGVGTNGSAPVYRVQSDFDYQSLALALYQEWIEL
DLFNWGLAKFSVAEFEAWGINAEDRYLIEYMANQEIGHATLITNMLGSNAPKQCTYNYPVNTVPEFIDFNQKLTR
WGESGVYGFLPHLDSRPAAQMLLQSITTEARQQMIFRQLGGLFPMPEWQIPGIPQSWAWTLLAPYISSCPQNQTR
LVWQNFPAMRIVNQPNPARVNGSNAISETVGGSSNTLSTAGIPPSQLCINQTDPLLNCSPAVTHNRSIPLSFPGR
LVYLQWDAPGQLVGPNNSYVTTTTALEPKFAAWVSQLNVTYSPLFNVSGKSRTAWTIQPNVSTWLGDPAINGTMF
LALTDEDLYVTPYNLTMLNPHVAALAVYQAG*
Coding >Ophun1|3388
ATGCCATCTAACAAGCTCCTAGGCCTTTGGCTCACGCTGTTGAGCTGCGCCCACGCAGCCCCTGCCGCATCTTCA
TCTCTGACGGGCCCCTTTCCATCTTCCCCATCTGGGTTGCCTCCCTTCCCGTTCCCATTCTCAATCCCATCTCAG
CCTCAGCCATCAGTTGTCTCTTATACCGACGTCACGTCTCACGGACCCTACACTGGCCCTTCAGCCACCACGACA
GGCGCCCTCTCAACTTCGGTCCTGAGTCCATCCATCTCGGCTCTGCCTCCGCCCCCGGGCTCGTACGACTACCCG
GCCGATGGCTTGCTTCATGCCAACCAGCCAGCTCCGTTTACGCCCAGCGGAGGCGTCGGCACCAACGGTTCGGCG
CCCGTCTACCGCGTCCAGAGCGACTTTGACTACCAGTCTCTTGCGCTGGCCCTCTATCAGGAATGGATAGAGCTG
GACCTCTTCAACTGGGGGCTCGCCAAGTTCAGTGTCGCCGAGTTTGAAGCCTGGGGGATCAATGCCGAGGACCGC
TACCTTATAGAGTACATGGCGAACCAGGAGATCGGCCACGCGACGCTCATAACTAATATGCTAGGCTCGAATGCG
CCCAAGCAGTGCACATACAACTACCCAGTCAACACGGTGCCCGAGTTCATCGACTTCAACCAGAAGCTCACGCGA
TGGGGCGAGTCTGGCGTCTACGGCTTCCTGCCTCATCTCGACTCGAGGCCCGCGGCTCAGATGCTGCTGCAGAGC
ATCACCACCGAGGCTCGTCAGCAGATGATCTTTCGCCAGCTGGGCGGCTTGTTTCCCATGCCTGAGTGGCAGATA
CCCGGTATCCCCCAGAGCTGGGCTTGGACTCTGCTGGCGCCATACATCTCGAGCTGTCCGCAGAATCAGACGCGT
CTTGTGTGGCAGAACTTTCCTGCGATGCGCATCGTCAATCAGCCTAATCCAGCGCGAGTCAACGGATCAAATGCC
ATCAGTGAGACGGTGGGGGGGTCAAGCAACACGCTCTCTACCGCGGGCATCCCTCCTTCGCAGCTCTGCATCAAC
CAGACCGACCCGCTCCTCAACTGCTCGCCCGCAGTCACCCACAACCGGAGCATTCCCCTATCCTTCCCTGGCCGC
CTCGTGTATCTGCAGTGGGATGCGCCGGGGCAGCTGGTCGGTCCCAACAACAGCTACGTTACGACGACGACGGCG
CTGGAGCCCAAGTTTGCCGCTTGGGTTTCGCAGCTCAACGTGACGTATTCGCCGCTGTTCAACGTGAGCGGGAAG
AGCAGGACGGCGTGGACAATTCAGCCGAATGTGTCGACCTGGCTGGGCGATCCGGCCATCAACGGCACCATGTTT
TTGGCGCTGACGGATGAGGACTTGTACGTGACGCCGTATAACTTGACTATGCTGAATCCGCATGTTGCGGCGCTG
GCGGTATATCAGGCTGGTTAG
Transcript >Ophun1|3388
ATGCCATCTAACAAGCTCCTAGGCCTTTGGCTCACGCTGTTGAGCTGCGCCCACGCAGCCCCTGCCGCATCTTCA
TCTCTGACGGGCCCCTTTCCATCTTCCCCATCTGGGTTGCCTCCCTTCCCGTTCCCATTCTCAATCCCATCTCAG
CCTCAGCCATCAGTTGTCTCTTATACCGACGTCACGTCTCACGGACCCTACACTGGCCCTTCAGCCACCACGACA
GGCGCCCTCTCAACTTCGGTCCTGAGTCCATCCATCTCGGCTCTGCCTCCGCCCCCGGGCTCGTACGACTACCCG
GCCGATGGCTTGCTTCATGCCAACCAGCCAGCTCCGTTTACGCCCAGCGGAGGCGTCGGCACCAACGGTTCGGCG
CCCGTCTACCGCGTCCAGAGCGACTTTGACTACCAGTCTCTTGCGCTGGCCCTCTATCAGGAATGGATAGAGCTG
GACCTCTTCAACTGGGGGCTCGCCAAGTTCAGTGTCGCCGAGTTTGAAGCCTGGGGGATCAATGCCGAGGACCGC
TACCTTATAGAGTACATGGCGAACCAGGAGATCGGCCACGCGACGCTCATAACTAATATGCTAGGCTCGAATGCG
CCCAAGCAGTGCACATACAACTACCCAGTCAACACGGTGCCCGAGTTCATCGACTTCAACCAGAAGCTCACGCGA
TGGGGCGAGTCTGGCGTCTACGGCTTCCTGCCTCATCTCGACTCGAGGCCCGCGGCTCAGATGCTGCTGCAGAGC
ATCACCACCGAGGCTCGTCAGCAGATGATCTTTCGCCAGCTGGGCGGCTTGTTTCCCATGCCTGAGTGGCAGATA
CCCGGTATCCCCCAGAGCTGGGCTTGGACTCTGCTGGCGCCATACATCTCGAGCTGTCCGCAGAATCAGACGCGT
CTTGTGTGGCAGAACTTTCCTGCGATGCGCATCGTCAATCAGCCTAATCCAGCGCGAGTCAACGGATCAAATGCC
ATCAGTGAGACGGTGGGGGGGTCAAGCAACACGCTCTCTACCGCGGGCATCCCTCCTTCGCAGCTCTGCATCAAC
CAGACCGACCCGCTCCTCAACTGCTCGCCCGCAGTCACCCACAACCGGAGCATTCCCCTATCCTTCCCTGGCCGC
CTCGTGTATCTGCAGTGGGATGCGCCGGGGCAGCTGGTCGGTCCCAACAACAGCTACGTTACGACGACGACGGCG
CTGGAGCCCAAGTTTGCCGCTTGGGTTTCGCAGCTCAACGTGACGTATTCGCCGCTGTTCAACGTGAGCGGGAAG
AGCAGGACGGCGTGGACAATTCAGCCGAATGTGTCGACCTGGCTGGGCGATCCGGCCATCAACGGCACCATGTTT
TTGGCGCTGACGGATGAGGACTTGTACGTGACGCCGTATAACTTGACTATGCTGAATCCGCATGTTGCGGCGCTG
GCGGTATATCAGGCTGGTTAG
Gene >Ophun1|3388
ATGCCATCTAACAAGCTCCTAGGCCTTTGGCTCACGCTGTTGAGCTGCGCCCACGCAGCCCCTGCCGCATCTTCA
TCTCTGACGGGCCCCTTTCCATCTTCCCCATCTGGGTTGCCTCCCTTCCCGTTCCCATTCTCAATCCCATCTCAG
CCTCAGCCATCAGTTGTCTCTTATACCGACGTCACGTCTCACGGACCCTACACTGGCCCTTCAGCCACCACGACA
GGCGCCCTCTCAACTTCGGTCCTGAGTCCATCCATCTCGGCTCTGCCTCCGCCCCCGGGCTCGTACGACTACCCG
GCCGATGGCTTGCTTCATGCCAACCAGCCAGCTCCGTTTACGCCCAGCGGAGGCGTCGGCACCAACGGTTCGGCG
CCCGTCTACCGCGTCCAGAGCGACTTTGACTACCAGTCTCTTGCGCTGGCCCTCTATCAGGAATGGATAGAGCTG
GACCTCTTCAACTGGGGGCTCGCCAAGTTCAGTGTCGCCGAGTTTGAAGCCTGGGGGATCAATGCCGAGGACCGC
TACCTTATAGAGTACATGGCGAACCAGGAGATCGGCCACGCGACGCTCATAACTAATATGCTAGGCTCGAATGCG
CCCAAGCAGTGCACATACAACTACCCAGTCAACACGGTGCCCGAGTTCATCGACTTCAACCAGAAGCTCACGCGA
TGGGGCGAGTCTGGCGTCTACGGCTTCCTGCCTCATCTCGACTCGAGGCCCGCGGCTCAGATGCTGCTGCAGAGC
ATCACCACCGAGGCTCGTCAGCAGATGATCTTTCGCCAGCTGGGCGGCTTGTTTCCCATGCCTGAGTGGCAGATA
CCCGGTATCCCCCAGAGCTGGGCTTGGACTCTGCTGGCGCCATACATCTCGAGCTGTCCGCAGAATCAGACGCGT
CTTGTGTGGCAGAACTTTCCTGCGATGCGCATCGTCAATCAGCCTAATCCAGCGCGAGTCAACGGATCAAATGCC
ATCAGTGAGACGGTGGGGGGGTCAAGCAACACGCTCTCTACCGCGGGCATCCCTCCTTCGCAGCTCTGCATCAAC
CAGACCGACCCGCTCCTCAACTGCTCGCCCGCAGTCACCCACAACCGGAGCATTCCCCTATCCTTCCCTGGCCGC
CTCGTGTATCTGCAGTGGGATGCGCCGGGGCAGCTGGTCGGTCCCAACAACAGCTACGTTACGACGACGACGGCG
CTGGAGCCCAAGTTTGCCGCTTGGGTTTCGCAGCTCAACGTGACGTATTCGCCGCTGTTCAACGTGAGCGGGAAG
AGCAGGACGGCGTGGACAATTCAGCCGAATGTGTCGACCTGGCTGGGCGATCCGGCCATCAACGGCACCATGTTT
TTGGCGCTGACGGATGAGGACTTGTACGTGACGCCGTATAACTTGACTATGCTGAATCCGCATGTTGCGGCGCTG
GCGGTATATCAGGCTGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail