Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3384
Gene name
LocationContig_30:26242..27916
Strand-
Gene length (bp)1674
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 4.4E-13 344 449
PF08969 USP8_dimer USP8 dimerisation domain 8.7E-06 16 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 13 522 1.0E-62
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 310 490 2.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 324 491 5.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 296 490 1.0E-40
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 298 490 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 13 522 1.0E-62
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 310 490 2.0E-41
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 324 491 5.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 296 490 1.0E-40
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 298 490 2.0E-40
sp|Q54Q40|D1039_DICDI Probable ubiquitin thioesterase DG1039 OS=Dictyostelium discoideum GN=DG1039 PE=3 SV=1 289 501 2.0E-38
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 303 490 9.0E-38
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 338 520 1.0E-37
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 332 520 4.0E-37
sp|Q96FJ0|STALP_HUMAN AMSH-like protease OS=Homo sapiens GN=STAMBPL1 PE=1 SV=2 341 491 3.0E-36
sp|Q5R558|STALP_PONAB AMSH-like protease OS=Pongo abelii GN=STAMBPL1 PE=2 SV=1 341 491 2.0E-35
sp|Q76N33|STALP_MOUSE AMSH-like protease OS=Mus musculus GN=Stambpl1 PE=1 SV=1 330 491 4.0E-34
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 343 520 3.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0005515 protein binding Yes
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0101005 deubiquitinase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0005488 binding No
GO:0008237 metallopeptidase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4210
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4525
Ophiocordyceps australis map64 (Brazil) OphauB2|7601
Ophiocordyceps camponoti-floridani Ophcf2|00541
Ophiocordyceps camponoti-rufipedis Ophun1|3384 (this protein)
Ophiocordyceps kimflemingae Ophio5|7644
Ophiocordyceps subramaniannii Hirsu2|8593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3384
MEPRSSPRMTRPPPTVSELVAQAENFNFNVNIPFKNWARAAETLFHEASFAISDGNYGRAYMMLYRHSVLVLKCL
PSHPQFKDAESRRAFRPLSRRIDLALDHLEHIKPVLEEDCAEWERMAPEVGTGPLQYTTAYADFARRDPTLSGPA
RVLDASEHQELAVDLAQKELARRDRVKRVSRLPVSKDDGTTRRGSSLDDSSNLQRQMETARRALEQDHDYDDPAA
SPRASSSQPYYPSVARSQPVEYEASEHRRRPSYIAVPSRPPKDRIPAQPDVGVRPLESHTYDALPAVPRKIPLEE
RPLSTAPERPPRPPKGTPDGPSLPRKDRLAFKPGAYLENGDPIRSVFVPSNLRSTFLEIASKNTAAGLEMCGILC
GLPINNALFVRCLLIPDQRCTSDTCETENEGAMFDYCASEDLLVLGWIHTHPTQTCFMSSRDLHTQAGYQVMMPE
SIAIVCAPRFKPAYGIFRLTHPPGLDYILDCRHQDTFHQHTISNIYRETEHPEGHVYESDKLPFYVHDLRAK*
Coding >Ophun1|3384
ATGGAGCCTCGATCTTCGCCACGGATGACTCGTCCGCCGCCGACGGTCAGCGAGCTCGTCGCCCAGGCGGAAAAC
TTCAACTTCAACGTCAACATCCCGTTCAAGAACTGGGCCAGGGCGGCCGAGACGCTGTTCCATGAGGCTTCGTTT
GCCATTTCCGACGGCAACTACGGACGAGCGTACATGATGCTTTATCGCCACTCGGTCCTTGTTCTGAAATGCCTA
CCGTCGCATCCTCAGTTCAAAGATGCCGAAAGCCGCAGGGCGTTCCGGCCCTTGTCGAGGCGCATCGACCTCGCG
CTCGACCACCTGGAGCACATCAAGCCGGTGCTGGAGGAGGATTGCGCTGAGTGGGAACGAATGGCGCCTGAAGTC
GGCACCGGCCCTCTGCAATATACGACTGCATATGCAGACTTCGCAAGACGGGATCCCACCTTGAGCGGTCCTGCG
AGAGTGCTTGACGCGTCCGAGCATCAGGAGCTCGCTGTCGACTTGGCCCAGAAAGAGCTGGCGCGGAGGGACAGG
GTCAAGCGAGTATCTCGACTGCCCGTCTCGAAAGATGATGGCACTACGCGCCGCGGAAGCAGCCTCGACGATAGC
AGCAACCTGCAGAGGCAGATGGAAACCGCCCGACGAGCGTTGGAGCAGGATCACGACTACGACGACCCTGCTGCA
TCTCCCCGCGCCTCATCGTCCCAGCCCTATTATCCGTCGGTAGCCAGATCTCAACCGGTCGAATACGAGGCATCA
GAGCACCGGCGGCGACCGTCTTATATAGCTGTGCCTTCGCGGCCGCCGAAAGACAGGATCCCCGCGCAGCCGGAC
GTGGGGGTCCGGCCACTCGAGTCGCATACTTACGACGCGCTACCAGCCGTGCCTCGAAAGATCCCCCTAGAAGAG
AGACCCCTGTCCACGGCCCCCGAGCGGCCCCCTCGACCGCCCAAAGGAACCCCAGACGGGCCGTCGCTCCCTAGG
AAAGATCGGCTGGCCTTCAAGCCCGGGGCGTACCTGGAGAACGGCGATCCGATCCGGTCTGTGTTTGTTCCGAGC
AACCTGCGATCGACCTTTCTAGAGATTGCGTCGAAGAACACAGCAGCCGGGCTGGAAATGTGCGGGATACTCTGT
GGCTTGCCGATCAATAACGCCCTGTTCGTTCGATGTCTCCTCATCCCCGATCAGCGGTGCACATCGGACACATGC
GAGACGGAGAACGAAGGCGCCATGTTCGACTACTGCGCGAGCGAGGACCTTCTCGTGCTCGGATGGATCCACACG
CACCCGACGCAGACGTGCTTTATGAGCTCGCGAGACCTGCACACGCAGGCGGGCTACCAGGTGATGATGCCCGAG
AGCATCGCCATCGTCTGCGCTCCTAGATTCAAGCCGGCTTATGGCATCTTCCGCCTCACCCACCCGCCTGGGCTA
GATTATATCCTCGACTGCAGGCACCAAGACACCTTTCACCAGCACACCATCAGCAATATCTACCGGGAGACGGAG
CACCCCGAGGGGCACGTTTACGAGAGCGACAAGCTGCCGTTTTACGTGCATGACCTACGGGCGAAATAG
Transcript >Ophun1|3384
ATGGAGCCTCGATCTTCGCCACGGATGACTCGTCCGCCGCCGACGGTCAGCGAGCTCGTCGCCCAGGCGGAAAAC
TTCAACTTCAACGTCAACATCCCGTTCAAGAACTGGGCCAGGGCGGCCGAGACGCTGTTCCATGAGGCTTCGTTT
GCCATTTCCGACGGCAACTACGGACGAGCGTACATGATGCTTTATCGCCACTCGGTCCTTGTTCTGAAATGCCTA
CCGTCGCATCCTCAGTTCAAAGATGCCGAAAGCCGCAGGGCGTTCCGGCCCTTGTCGAGGCGCATCGACCTCGCG
CTCGACCACCTGGAGCACATCAAGCCGGTGCTGGAGGAGGATTGCGCTGAGTGGGAACGAATGGCGCCTGAAGTC
GGCACCGGCCCTCTGCAATATACGACTGCATATGCAGACTTCGCAAGACGGGATCCCACCTTGAGCGGTCCTGCG
AGAGTGCTTGACGCGTCCGAGCATCAGGAGCTCGCTGTCGACTTGGCCCAGAAAGAGCTGGCGCGGAGGGACAGG
GTCAAGCGAGTATCTCGACTGCCCGTCTCGAAAGATGATGGCACTACGCGCCGCGGAAGCAGCCTCGACGATAGC
AGCAACCTGCAGAGGCAGATGGAAACCGCCCGACGAGCGTTGGAGCAGGATCACGACTACGACGACCCTGCTGCA
TCTCCCCGCGCCTCATCGTCCCAGCCCTATTATCCGTCGGTAGCCAGATCTCAACCGGTCGAATACGAGGCATCA
GAGCACCGGCGGCGACCGTCTTATATAGCTGTGCCTTCGCGGCCGCCGAAAGACAGGATCCCCGCGCAGCCGGAC
GTGGGGGTCCGGCCACTCGAGTCGCATACTTACGACGCGCTACCAGCCGTGCCTCGAAAGATCCCCCTAGAAGAG
AGACCCCTGTCCACGGCCCCCGAGCGGCCCCCTCGACCGCCCAAAGGAACCCCAGACGGGCCGTCGCTCCCTAGG
AAAGATCGGCTGGCCTTCAAGCCCGGGGCGTACCTGGAGAACGGCGATCCGATCCGGTCTGTGTTTGTTCCGAGC
AACCTGCGATCGACCTTTCTAGAGATTGCGTCGAAGAACACAGCAGCCGGGCTGGAAATGTGCGGGATACTCTGT
GGCTTGCCGATCAATAACGCCCTGTTCGTTCGATGTCTCCTCATCCCCGATCAGCGGTGCACATCGGACACATGC
GAGACGGAGAACGAAGGCGCCATGTTCGACTACTGCGCGAGCGAGGACCTTCTCGTGCTCGGATGGATCCACACG
CACCCGACGCAGACGTGCTTTATGAGCTCGCGAGACCTGCACACGCAGGCGGGCTACCAGGTGATGATGCCCGAG
AGCATCGCCATCGTCTGCGCTCCTAGATTCAAGCCGGCTTATGGCATCTTCCGCCTCACCCACCCGCCTGGGCTA
GATTATATCCTCGACTGCAGGCACCAAGACACCTTTCACCAGCACACCATCAGCAATATCTACCGGGAGACGGAG
CACCCCGAGGGGCACGTTTACGAGAGCGACAAGCTGCCGTTTTACGTGCATGACCTACGGGCGAAATAG
Gene >Ophun1|3384
ATGGAGCCTCGATCTTCGCCACGGATGACTCGTCCGCCGCCGACGGTCAGCGAGCTCGTCGCCCAGGCGGAAAAC
TTCAACTTCAACGTCAACATCCCGTTCAAGAACTGGGCCAGGGCGGCCGAGACGCTGTTCCATGAGGTCGGACTC
GCTTCGCCATGGCCGGCCTATCGCTGACTGTCGTCCCCTGCACAGGCTTCGTTTGCCATTTCCGACGGCAACTAC
GGACGAGCGTACATGATGCTTTATCGCCACTCGGTCCTTGTTCTGAAATGCCTACCGTCGCATCCTCAGTTCAAA
GATGCCGAAAGCCGCAGGGCGTTCCGGCCCTTGTCGAGGCGCATCGACCTCGCGCTCGACCACCTGGAGCACATC
AAGCCGGTGCTGGAGGAGGATTGCGCTGAGTGGGAACGAATGGCGCCTGAAGTCGGCACCGGCCCTCTGCAATAT
ACGACTGCATATGCAGACTTCGCAAGACGGGATCCCACCTTGAGCGGTCCTGCGAGAGTGCTTGACGCGTCCGAG
CATCAGGAGCTCGCTGTCGACTTGGCCCAGAAAGAGCTGGCGCGGAGGGACAGGGTCAAGCGAGTATCTCGACTG
CCCGTCTCGAAAGATGATGGCACTACGCGCCGCGGAAGCAGCCTCGACGATAGCAGCAACCTGCAGAGGCAGATG
GAAACCGCCCGACGAGCGTTGGAGCAGGATCACGACTACGACGACCCTGCTGCATCTCCCCGCGCCTCATCGTCC
CAGCCCTATTATCCGTCGGTAGCCAGATCTCAACCGGTCGAATACGAGGCATCAGAGCACCGGCGGCGACCGTCT
TATATAGCTGTGCCTTCGCGGCCGCCGAAAGACAGGATCCCCGCGCAGCCGGACGTGGGGGTCCGGCCACTCGAG
TCGCATACTTACGACGCGCTACCAGCCGTGCCTCGAAAGATCCCCCTAGAAGAGAGACCCCTGTCCACGGCCCCC
GAGCGGCCCCCTCGACCGCCCAAAGGAACCCCAGACGGGCCGTCGCTCCCTAGGAAAGATCGGCTGGCCTTCAAG
CCCGGGGCGTACCTGGAGAACGGCGATCCGATCCGGTCTGTGTTTGTTCCGAGCAACCTGCGATCGACCTTTCTA
GAGATTGCGTCGAAGAACACAGCAGCCGGGCTGGAAATGTGCGGGATACTCTGTGGCTTGCCGATCAATAACGCC
CTGTTCGTTCGATGTCTCCTCATCCCCGATCAGCGGTGCACATCGGACACATGCGAGACGGAGAACGAAGGCGCC
ATGTTCGACTACTGCGCGAGCGAGGACCTTCTCGTGCTCGGATGGATCCACACGCACCCGACGCAGACGTGCTTT
ATGAGCTCGCGAGACCTGCACACGCAGGCGGGCTACCAGGTGATGATGCCCGAGAGCATCGCCATCGTCTGCGCT
CCTAGATTCAAGCCGGCGTGAGTGCCCCCTGTCTGGGGCTTGCAGAGGGTCGCTGACCGGTCTGGCAGTTATGGC
ATCTTCCGCCTCACCCACCCGCCTGGGCTAGATTATATCCTCGACTGCAGGCACCAAGACACCTTTCACCAGCAC
ACCATCAGCAATATCTACCGGGAGACGGAGCACCCCGAGGGGCACGTTTACGAGAGCGACAAGCTGCCGTTTTAC
GTGCATGACCTACGGGCGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail