Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3382
Gene name
LocationContig_30:15155..21610
Strand+
Gene length (bp)6455
Transcript length (bp)4281
Coding sequence length (bp)4281
Protein length (aa) 1427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 1.3E-124 927 1399
PF13520 AA_permease_2 Amino acid permease 9.0E-27 195 406
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 1.2E-24 591 877

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O06837|STYD_PSEFL Phenylacetaldehyde dehydrogenase OS=Pseudomonas fluorescens GN=styD PE=1 SV=1 915 1403 8.0E-81
sp|A6VEI4|BETB_PSEA7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betB PE=3 SV=1 906 1405 1.0E-79
sp|A3M365|BETB_ACIBT NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=betB PE=3 SV=2 906 1407 2.0E-79
sp|Q0TKW0|BETB_ECOL5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betB PE=3 SV=1 906 1407 2.0E-79
sp|Q02DY9|BETB_PSEAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betB PE=3 SV=1 906 1405 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O06837|STYD_PSEFL Phenylacetaldehyde dehydrogenase OS=Pseudomonas fluorescens GN=styD PE=1 SV=1 915 1403 8.0E-81
sp|A6VEI4|BETB_PSEA7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betB PE=3 SV=1 906 1405 1.0E-79
sp|A3M365|BETB_ACIBT NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=betB PE=3 SV=2 906 1407 2.0E-79
sp|Q0TKW0|BETB_ECOL5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betB PE=3 SV=1 906 1407 2.0E-79
sp|Q02DY9|BETB_PSEAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betB PE=3 SV=1 906 1405 2.0E-79
sp|Q9HTJ1|BETB_PSEAE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betB PE=1 SV=1 906 1405 2.0E-79
sp|B7V5R4|BETB_PSEA8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betB PE=3 SV=1 906 1405 2.0E-79
sp|B0VST2|BETB_ACIBS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betB PE=3 SV=1 906 1407 4.0E-79
sp|B2HV80|BETB_ACIBC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betB PE=3 SV=1 906 1407 4.0E-79
sp|B0V944|BETB_ACIBY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betB PE=3 SV=1 906 1407 5.0E-79
sp|B7I896|BETB_ACIB5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betB PE=3 SV=1 906 1407 5.0E-79
sp|B7GYG4|BETB_ACIB3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betB PE=3 SV=1 906 1407 5.0E-79
sp|A8GBX8|BETB_SERP5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=betB PE=3 SV=1 906 1405 5.0E-79
sp|O34660|ALDH4_BACSU Putative aldehyde dehydrogenase DhaS OS=Bacillus subtilis (strain 168) GN=dhaS PE=3 SV=1 909 1405 5.0E-79
sp|C0RHQ3|BETB_BRUMB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=betB PE=3 SV=1 925 1402 1.0E-78
sp|Q985M6|BETB_RHILO NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betB PE=3 SV=1 915 1405 1.0E-78
sp|Q8G1Z9|BETB_BRUSU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|A9M9H7|BETB_BRUC2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|C3K3D2|BETB_PSEFS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betB PE=3 SV=1 906 1405 2.0E-78
sp|A5VPA5|BETB_BRUO2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|Q8YFY0|BETB_BRUME NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betB PE=3 SV=2 925 1402 2.0E-78
sp|Q57EI0|BETB_BRUAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|Q2YMP8|BETB_BRUA2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain 2308) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|B2SA42|BETB_BRUA1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain S19) GN=betB PE=3 SV=1 925 1402 2.0E-78
sp|Q4ZM62|BETB_PSEU2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betB PE=3 SV=1 906 1405 2.0E-78
sp|B0CKN3|BETB_BRUSI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betB PE=3 SV=1 919 1402 3.0E-78
sp|Q48CM6|BETB_PSE14 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betB PE=3 SV=1 906 1405 4.0E-78
sp|B7M2V6|BETB_ECO8A NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betB PE=3 SV=1 906 1407 5.0E-78
sp|A6X2G8|BETB_OCHA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betB PE=3 SV=1 929 1402 7.0E-78
sp|B6I075|BETB_ECOSE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=betB PE=3 SV=1 906 1407 9.0E-78
sp|Q6FDF8|BETB_ACIAD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betB PE=3 SV=1 906 1407 2.0E-77
sp|A7ZI51|BETB_ECO24 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betB PE=3 SV=1 906 1407 2.0E-77
sp|B7L441|BETB_ECO55 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betB PE=3 SV=1 906 1407 3.0E-77
sp|Q9STS1|BADH2_ARATH Betaine aldehyde dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=ALDH10A9 PE=2 SV=1 928 1405 3.0E-77
sp|Q8FKI8|BETB_ECOL6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betB PE=3 SV=3 906 1407 3.0E-77
sp|O94788|AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens GN=ALDH1A2 PE=1 SV=3 924 1402 5.0E-77
sp|P17445|BETB_ECOLI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=betB PE=1 SV=3 906 1407 5.0E-77
sp|B1XET7|BETB_ECODH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betB PE=3 SV=1 906 1407 5.0E-77
sp|B7N8L4|BETB_ECOLU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betB PE=3 SV=1 906 1407 5.0E-77
sp|B7MCD1|BETB_ECO45 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betB PE=3 SV=1 906 1407 9.0E-77
sp|Q4K4K8|BETB_PSEF5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betB PE=3 SV=1 906 1405 1.0E-76
sp|A7ZWV5|BETB_ECOHS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betB PE=3 SV=1 906 1407 1.0E-76
sp|Q3K5H4|BETB_PSEPF NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=betB PE=3 SV=1 906 1405 1.0E-76
sp|B1J0W5|BETB_ECOLC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betB PE=3 SV=1 906 1407 1.0E-76
sp|P17202|BADH_SPIOL Betaine aldehyde dehydrogenase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 928 1405 2.0E-76
sp|B7UJG5|BETB_ECO27 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betB PE=3 SV=1 906 1407 2.0E-76
sp|B1LIJ8|BETB_ECOSM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betB PE=3 SV=1 906 1407 3.0E-76
sp|Q88AE9|BETB_PSESM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betB PE=3 SV=1 906 1405 3.0E-76
sp|Q0T7M9|BETB_SHIF8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betB PE=3 SV=1 906 1407 3.0E-76
sp|P40108|ALDH_DAVTA Aldehyde dehydrogenase OS=Davidiella tassiana GN=CLAH10 PE=1 SV=2 914 1406 3.0E-76
sp|B5Z1R1|BETB_ECO5E NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betB PE=3 SV=1 906 1407 3.0E-76
sp|Q7AH91|BETB_ECO57 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=betB PE=3 SV=3 906 1407 3.0E-76
sp|B7NK50|BETB_ECO7I NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=betB PE=3 SV=1 906 1407 5.0E-76
sp|Q1IG69|BETB_PSEE4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betB PE=3 SV=1 932 1402 6.0E-76
sp|B1Z033|BETB_BURA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betB PE=3 SV=1 924 1402 7.0E-76
sp|B0KN18|BETB_PSEPG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betB PE=3 SV=1 932 1402 8.0E-76
sp|O93344|AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus GN=ALDH1A2 PE=2 SV=2 924 1402 8.0E-76
sp|A6W2P7|BETB_MARMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=betB PE=3 SV=1 932 1407 9.0E-76
sp|B2JS88|BETB_BURP8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betB PE=3 SV=1 932 1407 1.0E-75
sp|B1J2K9|BETB_PSEPW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain W619) GN=betB PE=3 SV=1 932 1402 2.0E-75
sp|O59808|BADH_SCHPO Probable betaine aldehyde dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu8 PE=2 SV=1 928 1399 3.0E-75
sp|Q62148|AL1A2_MOUSE Retinal dehydrogenase 2 OS=Mus musculus GN=Aldh1a2 PE=1 SV=2 924 1402 3.0E-75
sp|O24174|BADH1_ORYSJ Betaine aldehyde dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=BADH1 PE=1 SV=1 917 1405 3.0E-75
sp|Q63639|AL1A2_RAT Retinal dehydrogenase 2 OS=Rattus norvegicus GN=Aldh1a2 PE=1 SV=2 924 1402 4.0E-75
sp|Q0B712|BETB_BURCM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betB PE=3 SV=1 924 1402 7.0E-75
sp|Q39A43|BETB_BURL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betB PE=3 SV=1 924 1402 7.0E-75
sp|B1K708|BETB_BURCC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betB PE=3 SV=1 924 1402 8.0E-75
sp|Q9I8W8|AL1A2_TAEGU Retinal dehydrogenase 2 OS=Taeniopygia guttata GN=ALDH1A2 PE=2 SV=1 924 1402 9.0E-75
sp|Q88CW7|BETB_PSEPK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betB PE=3 SV=1 932 1402 9.0E-75
sp|A5WA96|BETB_PSEP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betB PE=3 SV=1 932 1402 9.0E-75
sp|C6DKY5|BETB_PECCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betB PE=3 SV=1 906 1405 1.0E-74
sp|P42757|BADH_ATRHO Betaine aldehyde dehydrogenase, chloroplastic OS=Atriplex hortensis PE=2 SV=1 928 1405 2.0E-74
sp|Q25417|ALDH2_LEITA Aldehyde dehydrogenase, mitochondrial OS=Leishmania tarentolae GN=ALDH2 PE=1 SV=1 914 1399 2.0E-74
sp|B4EHJ1|BETB_BURCJ NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betB PE=3 SV=1 924 1402 2.0E-74
sp|Q6D6E0|BETB_PECAS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=betB PE=3 SV=1 906 1405 2.0E-74
sp|P46367|ALDH4_YEAST Potassium-activated aldehyde dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD4 PE=1 SV=2 914 1399 2.0E-74
sp|Q6GCV9|ALDA_STAAS Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MSSA476) GN=aldA PE=3 SV=1 898 1410 3.0E-74
sp|Q13NG6|BETB_BURXL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betB PE=3 SV=1 932 1407 3.0E-74
sp|Q87H52|BETB_VIBPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=betB PE=3 SV=1 932 1405 3.0E-74
sp|A9AN00|BETB_BURM1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=betB PE=3 SV=1 924 1402 3.0E-74
sp|A0B2F6|BETB_BURCH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betB PE=3 SV=1 932 1402 4.0E-74
sp|Q1BQE1|BETB_BURCA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betB PE=3 SV=1 932 1402 4.0E-74
sp|Q6GKD8|ALDA_STAAR Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MRSA252) GN=aldA PE=3 SV=1 898 1410 6.0E-74
sp|B2TCJ9|BETB_BURPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betB PE=3 SV=1 932 1407 8.0E-74
sp|A4WUY6|BETB_RHOS5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=betB PE=3 SV=1 915 1402 1.0E-73
sp|P86886|AL1A1_MESAU Retinal dehydrogenase 1 OS=Mesocricetus auratus GN=ALDH1A1 PE=1 SV=1 924 1402 1.0E-73
sp|Q5HJK3|ALDA_STAAC Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain COL) GN=aldA PE=3 SV=1 898 1410 1.0E-73
sp|Q2G1J0|ALDA_STAA8 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain NCTC 8325) GN=aldA PE=3 SV=1 898 1410 1.0E-73
sp|Q2FK94|ALDA_STAA3 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain USA300) GN=aldA PE=3 SV=1 898 1410 1.0E-73
sp|P24549|AL1A1_MOUSE Retinal dehydrogenase 1 OS=Mus musculus GN=Aldh1a1 PE=1 SV=5 924 1399 1.0E-73
sp|A4XPI6|BETB_PSEMY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betB PE=3 SV=1 904 1402 1.0E-73
sp|Q7A1Y7|ALDA_STAAW Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MW2) GN=aldA PE=3 SV=1 898 1410 1.0E-73
sp|Q7A825|ALDA_STAAN Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain N315) GN=aldA PE=1 SV=1 898 1410 1.0E-73
sp|Q99X54|ALDA_STAAM Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aldA PE=3 SV=1 898 1410 1.0E-73
sp|Q8CN24|ALDA_STAES Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=aldA PE=3 SV=1 912 1410 2.0E-73
sp|Q5HLA3|ALDA_STAEQ Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=aldA PE=3 SV=1 912 1410 2.0E-73
sp|Q4L919|ALDA_STAHJ Putative aldehyde dehydrogenase AldA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=aldA PE=3 SV=1 909 1410 2.0E-73
sp|A4JJG5|BETB_BURVG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betB PE=3 SV=1 924 1402 3.0E-73
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 591 902 3.0E-73
sp|Q9S795|BADH1_ARATH Betaine aldehyde dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=ALDH10A8 PE=2 SV=1 928 1399 4.0E-73
sp|A3PI00|BETB_RHOS1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=betB PE=3 SV=1 915 1402 4.0E-73
sp|Q3J4E9|BETB_RHOS4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=betB PE=3 SV=1 915 1402 8.0E-73
sp|Q2YV11|ALDA_STAAB Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aldA PE=3 SV=1 898 1410 9.0E-73
sp|O04895|BADH_AMAHP Betaine aldehyde dehydrogenase, chloroplastic OS=Amaranthus hypochondriacus GN=BADH4 PE=3 SV=1 928 1399 9.0E-73
sp|P13601|AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus GN=Aldh1a7 PE=1 SV=2 924 1399 2.0E-72
sp|A1UVS4|BETB_BURMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=betB PE=3 SV=1 932 1407 3.0E-72
sp|Q62CH7|BETB_BURMA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=betB PE=3 SV=1 932 1407 3.0E-72
sp|A2RWD6|BETB_BURM9 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=betB PE=3 SV=1 932 1407 3.0E-72
sp|A3MEC6|BETB_BURM7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=betB PE=3 SV=1 932 1407 3.0E-72
sp|Q66D53|BETB_YERPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betB PE=3 SV=1 906 1402 3.0E-72
sp|Q63KK8|BETB_BURPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=betB PE=3 SV=1 932 1407 4.0E-72
sp|P28237|BADH_BETVU Betaine aldehyde dehydrogenase, chloroplastic OS=Beta vulgaris PE=2 SV=1 928 1405 4.0E-72
sp|P51647|AL1A1_RAT Retinal dehydrogenase 1 OS=Rattus norvegicus GN=Aldh1a1 PE=1 SV=3 924 1399 4.0E-72
sp|Q9SU63|AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=2 SV=1 924 1400 5.0E-72
sp|A3NKP8|BETB_BURP6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=betB PE=3 SV=1 932 1407 5.0E-72
sp|B1JSQ9|BETB_YERPY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betB PE=3 SV=1 906 1402 5.0E-72
sp|A6U6Y9|BETB_SINMW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betB PE=3 SV=1 925 1401 6.0E-72
sp|A7FKL5|BETB_YERP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betB PE=3 SV=1 906 1402 6.0E-72
sp|Q56YU0|AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana GN=ALDH2C4 PE=1 SV=2 905 1401 8.0E-72
sp|B2K8U5|BETB_YERPB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betB PE=3 SV=1 906 1402 8.0E-72
sp|B9JBA3|BETB_AGRRK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betB PE=3 SV=1 924 1407 9.0E-72
sp|A4TNP1|BETB_YERPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betB PE=3 SV=1 906 1402 9.0E-72
sp|Q1CFR8|BETB_YERPN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betB PE=3 SV=1 906 1402 9.0E-72
sp|Q8ZGV9|BETB_YERPE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis GN=betB PE=3 SV=1 906 1402 9.0E-72
sp|Q1C931|BETB_YERPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betB PE=3 SV=1 906 1402 9.0E-72
sp|B9KNS6|BETB_RHOSK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=betB PE=3 SV=1 915 1402 9.0E-72
sp|Q3JLL8|BETB_BURP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=betB PE=3 SV=1 932 1407 2.0E-71
sp|A3P6B0|BETB_BURP0 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=betB PE=3 SV=1 932 1407 2.0E-71
sp|O35945|AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus GN=Aldh1a7 PE=1 SV=1 928 1399 3.0E-71
sp|B5Y007|BETB_KLEP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=betB PE=3 SV=1 906 1407 3.0E-71
sp|P40047|ALDH5_YEAST Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD5 PE=1 SV=4 932 1399 5.0E-71
sp|A6ZR27|ALDH5_YEAS7 Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ALD5 PE=3 SV=1 932 1399 5.0E-71
sp|B7VQ28|BETB_VIBTL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=betB PE=3 SV=1 910 1405 7.0E-71
sp|C3MIE5|BETB_RHISN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betB PE=3 SV=1 925 1407 7.0E-71
sp|Q40024|BADH_HORVU Betaine aldehyde dehydrogenase OS=Hordeum vulgare PE=2 SV=1 904 1399 7.0E-71
sp|P42269|HPCC_ECOLX 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase OS=Escherichia coli GN=hpcC PE=3 SV=1 915 1397 9.0E-71
sp|H2IFE7|AHGD_VIBSJ 3,6-anhydro-alpha-L-galactose dehydrogenase OS=Vibrio sp. (strain EJY3) GN=Vejahgd PE=1 SV=1 912 1403 2.0E-70
sp|B5ZUG3|BETB_RHILW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betB PE=3 SV=1 924 1407 2.0E-70
sp|P54222|BETB1_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 1 OS=Rhizobium meliloti (strain 1021) GN=betB1 PE=3 SV=2 925 1401 2.0E-70
sp|P23883|PUUC_ECOLI Aldehyde dehydrogenase PuuC OS=Escherichia coli (strain K12) GN=puuC PE=1 SV=2 914 1402 2.0E-70
sp|P54115|ALDH6_YEAST Magnesium-activated aldehyde dehydrogenase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD6 PE=1 SV=4 924 1399 3.0E-70
sp|B2FQ90|BETB_STRMK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=betB PE=3 SV=1 905 1405 3.0E-70
sp|P47895|AL1A3_HUMAN Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens GN=ALDH1A3 PE=1 SV=2 932 1405 3.0E-70
sp|Q1MJU3|BETB_RHIL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betB PE=3 SV=1 924 1401 4.0E-70
sp|B4SHW0|BETB_STRM5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=betB PE=3 SV=1 905 1405 5.0E-70
sp|P54114|ALDH3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD3 PE=1 SV=1 914 1402 6.0E-70
sp|Q2KB42|BETB_RHIEC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betB PE=3 SV=1 906 1401 8.0E-70
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 604 902 2.0E-69
sp|A4VKC2|BETB_PSEU5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=betB PE=3 SV=1 905 1405 2.0E-69
sp|P30842|CROM_NOTSL Omega-crystallin OS=Nototodarus sloanii PE=2 SV=3 929 1400 2.0E-69
sp|Q84LK3|BADH2_ORYSJ Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=BADH2 PE=1 SV=1 906 1405 2.0E-69
sp|B3VMC0|BADH2_ORYSI Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. indica GN=BADH2 PE=2 SV=1 906 1405 2.0E-69
sp|P51977|AL1A1_SHEEP Retinal dehydrogenase 1 OS=Ovis aries GN=ALDH1A1 PE=1 SV=2 924 1402 2.0E-69
sp|B3PTE1|BETB_RHIE6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betB PE=3 SV=1 924 1407 2.0E-69
sp|Q2XQV4|ALDH2_PIG Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa GN=ALDH2 PE=2 SV=1 928 1402 2.0E-69
sp|P20000|ALDH2_BOVIN Aldehyde dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH2 PE=1 SV=2 928 1401 3.0E-69
sp|P48644|AL1A1_BOVIN Retinal dehydrogenase 1 OS=Bos taurus GN=ALDH1A1 PE=2 SV=3 924 1402 3.0E-69
sp|Q9ZA11|ALDH_RHORT Aldehyde dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0931 PE=3 SV=2 933 1403 3.0E-69
sp|O74187|ALDH_AGABI Aldehyde dehydrogenase OS=Agaricus bisporus GN=aldA PE=3 SV=1 914 1402 4.0E-69
sp|Q8PPG7|BETB_XANAC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betB PE=3 SV=1 904 1402 4.0E-69
sp|Q8S528|AL2B7_ARATH Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2 924 1402 4.0E-69
sp|Q3BXK7|BETB_XANC5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betB PE=3 SV=1 906 1402 6.0E-69
sp|Q8K4D8|AL1A3_RAT Aldehyde dehydrogenase family 1 member A3 OS=Rattus norvegicus GN=Aldh1a3 PE=2 SV=1 922 1402 8.0E-69
sp|Q8UH56|BETB_AGRFC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betB PE=1 SV=1 933 1402 8.0E-69
sp|Q9CZS1|AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus GN=Aldh1b1 PE=1 SV=1 928 1402 1.0E-68
sp|A8GHZ8|ABDH_SERP5 Gamma-aminobutyraldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=prr PE=3 SV=1 914 1403 1.0E-68
sp|P47771|ALDH2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD2 PE=1 SV=2 914 1402 1.0E-68
sp|P42041|ALDH_ALTAL Aldehyde dehydrogenase OS=Alternaria alternata GN=ALTA10 PE=1 SV=2 924 1405 1.0E-68
sp|P15437|AL1A1_HORSE Retinal dehydrogenase 1 OS=Equus caballus GN=ALDH1A1 PE=1 SV=1 924 1402 2.0E-68
sp|P12762|ALDH2_HORSE Aldehyde dehydrogenase, mitochondrial OS=Equus caballus GN=ALDH2 PE=1 SV=1 928 1402 2.0E-68
sp|P00352|AL1A1_HUMAN Retinal dehydrogenase 1 OS=Homo sapiens GN=ALDH1A1 PE=1 SV=2 924 1402 2.0E-68
sp|Q8HYE4|AL1A1_MACFA Retinal dehydrogenase 1 OS=Macaca fascicularis GN=ALDH1A1 PE=2 SV=3 924 1402 3.0E-68
sp|P80668|FEAB_ECOLI Phenylacetaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=feaB PE=1 SV=2 914 1403 3.0E-68
sp|Q9JHW9|AL1A3_MOUSE Aldehyde dehydrogenase family 1 member A3 OS=Mus musculus GN=Aldh1a3 PE=1 SV=1 932 1405 3.0E-68
sp|Q7ZVB2|A9A1A_DANRE Aldehyde dehydrogenase family 9 member A1-A OS=Danio rerio GN=aldh9a1a PE=2 SV=1 916 1407 4.0E-68
sp|A8AGJ9|ABDH_CITK8 Gamma-aminobutyraldehyde dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=prr PE=3 SV=1 906 1403 4.0E-68
sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens GN=ALDH1B1 PE=1 SV=3 902 1402 5.0E-68
sp|Q19A30|AL9A1_ORYLA Aldehyde dehydrogenase family 9 member A1 OS=Oryzias latipes GN=aldh9A1 PE=2 SV=1 916 1408 6.0E-68
sp|Q5R6B5|AL1B1_PONAB Aldehyde dehydrogenase X, mitochondrial OS=Pongo abelii GN=ALDH1B1 PE=2 SV=1 902 1402 7.0E-68
sp|Q802W2|A9A1B_DANRE Aldehyde dehydrogenase family 9 member A1-B OS=Danio rerio GN=aldh9a1b PE=2 SV=2 929 1405 7.0E-68
sp|Q1RBX3|ABDH_ECOUT Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|Q8FHK7|ABDH_ECOL6 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|Q0THX6|ABDH_ECOL5 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|A1AB46|ABDH_ECOK1 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|B7MUN0|ABDH_ECO81 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|B7MMS8|ABDH_ECO45 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=prr PE=3 SV=1 912 1403 8.0E-68
sp|P41751|ALDH_ASPNG Aldehyde dehydrogenase OS=Aspergillus niger GN=aldA PE=3 SV=1 914 1406 1.0E-67
sp|O14293|YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.09c PE=1 SV=1 900 1402 1.0E-67
sp|P81178|ALDH2_MESAU Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1 928 1402 2.0E-67
sp|Q66HF8|AL1B1_RAT Aldehyde dehydrogenase X, mitochondrial OS=Rattus norvegicus GN=Aldh1b1 PE=1 SV=1 928 1405 2.0E-67
sp|P30841|CROM_ENTDO Omega-crystallin OS=Enteroctopus dofleini PE=1 SV=3 924 1400 3.0E-67
sp|Q5RF00|ALDH2_PONAB Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii GN=ALDH2 PE=2 SV=1 928 1402 3.0E-67
sp|B7URJ0|ABDH_ECO27 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=prr PE=3 SV=1 912 1403 3.0E-67
sp|B6IAI9|ABDH_ECOSE Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=prr PE=3 SV=1 912 1403 3.0E-67
sp|B7LZ33|ABDH_ECO8A Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=prr PE=3 SV=1 912 1403 3.0E-67
sp|A7ZLN7|ABDH_ECO24 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=prr PE=3 SV=1 912 1403 3.0E-67
sp|B7LR95|ABDH_ESCF3 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=prr PE=3 SV=1 912 1403 3.0E-67
sp|P47738|ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1 928 1402 4.0E-67
sp|Q3Z1H6|ABDH_SHISS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella sonnei (strain Ss046) GN=prr PE=3 SV=1 912 1403 5.0E-67
sp|C6DD82|ABDH_PECCP Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=prr PE=3 SV=1 914 1403 5.0E-67
sp|P08157|ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aldA PE=3 SV=2 914 1406 5.0E-67
sp|P05091|ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH2 PE=1 SV=2 928 1402 6.0E-67
sp|B1IS15|ABDH_ECOLC Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=prr PE=3 SV=1 912 1403 6.0E-67
sp|A8A002|ABDH_ECOHS Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=prr PE=3 SV=1 912 1403 6.0E-67
sp|P77674|ABDH_ECOLI Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=prr PE=1 SV=1 912 1403 6.0E-67
sp|B1XDF5|ABDH_ECODH Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=prr PE=3 SV=1 912 1403 6.0E-67
sp|C4ZVI3|ABDH_ECOBW Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=prr PE=3 SV=1 912 1403 6.0E-67
sp|Q8MI17|AL1A1_RABIT Retinal dehydrogenase 1 OS=Oryctolagus cuniculus GN=ALDH1A1 PE=2 SV=1 924 1402 6.0E-67
sp|Q83R90|ABDH_SHIFL Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri GN=prr PE=3 SV=1 912 1403 7.0E-67
sp|P0C6D7|ALDH_VIBCH Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aldA PE=3 SV=1 909 1403 8.0E-67
sp|A5F3A7|ALDH_VIBC3 Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aldA PE=3 SV=2 909 1403 8.0E-67
sp|Q8ZPC9|ABDH_SALTY Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prr PE=3 SV=2 912 1403 8.0E-67
sp|B1LFH3|ABDH_ECOSM Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=prr PE=3 SV=1 912 1403 1.0E-66
sp|Q6D6Y7|ABDH_PECAS Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=prr PE=3 SV=1 914 1403 1.0E-66
sp|P56533|BADH_GADMC Betaine aldehyde dehydrogenase OS=Gadus morhua subsp. callarias GN=aldh9A1 PE=1 SV=1 929 1405 1.0E-66
sp|Q0T431|ABDH_SHIF8 Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=prr PE=3 SV=1 912 1403 1.0E-66
sp|B7L6F9|ABDH_ECO55 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=prr PE=3 SV=1 912 1403 1.0E-66
sp|P11884|ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1 928 1402 2.0E-66
sp|B7N4K1|ABDH_ECOLU Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=prr PE=3 SV=1 912 1403 2.0E-66
sp|P71016|BETB_BACSU Betaine aldehyde dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsA PE=1 SV=1 932 1402 2.0E-66
sp|B5Z0W0|ABDH_ECO5E Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=prr PE=3 SV=1 912 1403 2.0E-66
sp|Q8X9W5|ABDH_ECO57 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=prr PE=3 SV=1 912 1403 2.0E-66
sp|A4WAR9|ABDH_ENT38 Gamma-aminobutyraldehyde dehydrogenase OS=Enterobacter sp. (strain 638) GN=prr PE=3 SV=1 914 1403 4.0E-66
sp|Q5PHV8|ABDH_SALPA Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=prr PE=3 SV=2 912 1403 4.0E-66
sp|Q32FQ5|ABDH_SHIDS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=prr PE=3 SV=1 912 1403 7.0E-66
sp|Q9RYG9|ALDH_DEIRA Aldehyde dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aldA PE=3 SV=1 922 1404 8.0E-66
sp|A7N2Q0|BETB_VIBCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betB PE=3 SV=1 932 1405 8.0E-66
sp|A9MQY3|ABDH_SALAR Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=prr PE=3 SV=1 912 1403 2.0E-65
sp|Q29490|ALDH1_MACPR Aldehyde dehydrogenase, cytosolic 1 OS=Macroscelides proboscideus GN=ALDH1 PE=2 SV=1 924 1405 3.0E-65
sp|P46369|THCA_RHOER EPTC-inducible aldehyde dehydrogenase OS=Rhodococcus erythropolis GN=thcA PE=1 SV=2 906 1411 3.0E-65
sp|P37685|ALDB_ECOLI Aldehyde dehydrogenase B OS=Escherichia coli (strain K12) GN=aldB PE=1 SV=2 922 1405 4.0E-65
sp|A9MYQ4|ABDH_SALPB Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=prr PE=3 SV=1 912 1403 4.0E-65
sp|Q8Z747|ABDH_SALTI Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhi GN=prr PE=3 SV=2 912 1403 8.0E-65
sp|Q28399|ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii GN=ALDH1 PE=1 SV=1 924 1405 2.0E-64
sp|Q27640|ALDH_ENCBU Aldehyde dehydrogenase OS=Enchytraeus buchholzi GN=ALDH PE=2 SV=1 932 1401 3.0E-64
sp|Q9H2A2|AL8A1_HUMAN Aldehyde dehydrogenase family 8 member A1 OS=Homo sapiens GN=ALDH8A1 PE=1 SV=1 932 1403 2.0E-63
sp|Q9URW9|YLX7_SCHPO Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.07c PE=3 SV=1 932 1405 2.0E-63
sp|Q9RJZ6|ALDH_STRCO Probable aldehyde dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1174 PE=3 SV=1 909 1404 2.0E-63
sp|Q9L4K1|BETB_CHRSD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betB PE=3 SV=1 906 1402 3.0E-63
sp|P27463|AL1A1_CHICK Retinal dehydrogenase 1 OS=Gallus gallus GN=ALDH1A1 PE=2 SV=1 924 1402 9.0E-63
sp|Q2KJH9|AL9A1_BOVIN 4-trimethylaminobutyraldehyde dehydrogenase OS=Bos taurus GN=ALDH9A1 PE=2 SV=1 932 1410 1.0E-62
sp|B0RNV0|BETB_XANCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betB PE=3 SV=1 904 1402 1.0E-62
sp|Q4UYN4|BETB_XANC8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betB PE=3 SV=1 904 1402 1.0E-62
sp|Q57P61|ABDH_SALCH Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=prr PE=3 SV=2 912 1403 2.0E-62
sp|Q66I21|AL8A1_DANRE Aldehyde dehydrogenase family 8 member A1 OS=Danio rerio GN=aldh8a1 PE=2 SV=1 932 1403 3.0E-62
sp|C0Q4N4|ABDH_SALPC Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=prr PE=3 SV=1 912 1403 4.0E-62
sp|Q6L285|GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0332 PE=1 SV=1 914 1416 9.0E-62
sp|P49189|AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens GN=ALDH9A1 PE=1 SV=3 932 1410 1.0E-61
sp|P46368|DHA2_CUPNH Acetaldehyde dehydrogenase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoD PE=1 SV=1 907 1404 1.0E-61
sp|Q8BH00|AL8A1_MOUSE Aldehyde dehydrogenase family 8 member A1 OS=Mus musculus GN=Aldh8a1 PE=1 SV=1 915 1403 2.0E-61
sp|F8JX40|FLUDE_STREN Fluoroacetaldehyde dehydrogenase OS=Streptomyces cattleya (strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057) GN=SCAT_0945 PE=1 SV=1 912 1404 3.0E-61
sp|Q8P5D8|BETB_XANCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=betB PE=3 SV=1 904 1402 3.0E-61
sp|Q53197|Y4UC_RHISN Putative aldehyde-dehydrogenase-like protein y4uC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01370 PE=3 SV=1 928 1402 3.0E-61
sp|Q0P5F9|AL8A1_BOVIN Aldehyde dehydrogenase family 8 member A1 OS=Bos taurus GN=ALDH8A1 PE=2 SV=1 932 1403 4.0E-61
sp|Q5R8A4|AL9A1_PONAB 4-trimethylaminobutyraldehyde dehydrogenase OS=Pongo abelii GN=ALDH9A1 PE=2 SV=2 932 1410 4.0E-61
sp|Q9JLJ2|AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus GN=Aldh9a1 PE=1 SV=1 932 1410 6.0E-61
sp|Q63ZT8|AL1L1_XENTR Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus tropicalis GN=aldh1l1 PE=2 SV=1 905 1403 7.0E-61
sp|Q9JLJ3|AL9A1_RAT 4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh9a1 PE=1 SV=1 932 1410 8.0E-61
sp|P9WNY1|ALDH_MYCTU Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0458 PE=1 SV=1 966 1405 1.0E-60
sp|P9WNY0|ALDH_MYCTO Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0474 PE=3 SV=1 966 1405 1.0E-60
sp|P63938|ALDH_MYCBO Probable aldehyde dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0467 PE=3 SV=1 966 1405 1.0E-60
sp|Q7MF13|BETB_VIBVY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betB PE=3 SV=1 915 1402 2.0E-60
sp|Q8D3K3|BETB_VIBVU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betB PE=3 SV=1 915 1402 2.0E-60
sp|P19059|DMPC_PSEUF 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas sp. (strain CF600) GN=dmpC PE=3 SV=1 932 1402 5.0E-60
sp|Q6GNL7|AL1L1_XENLA Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus laevis GN=aldh1l1 PE=2 SV=1 905 1403 6.0E-60
sp|P23105|XYLG_PSEPU 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas putida GN=xylG PE=1 SV=1 933 1402 2.0E-59
sp|Q9SAK4|SSDH_ARATH Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=ALDH5F1 PE=1 SV=2 915 1390 2.0E-59
sp|P32872|ALDHY_YEASX Aldehyde dehydrogenase 2, mitochondrial OS=Saccharomyces cerevisiae GN=ALD2 PE=3 SV=1 927 1386 3.0E-59
sp|B9F3B6|SSDH_ORYSJ Succinate-semialdehyde dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=ALDH5F1 PE=3 SV=1 915 1399 6.0E-59
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 425 897 6.0E-59
sp|Q88RC0|DAVD_PSEPK Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas putida (strain KT2440) GN=davD PE=3 SV=1 924 1390 2.0E-58
sp|P42236|ALDH1_BACSU Probable aldehyde dehydrogenase YcbD OS=Bacillus subtilis (strain 168) GN=ycbD PE=3 SV=1 906 1402 1.0E-57
sp|P28037|AL1L1_RAT Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Rattus norvegicus GN=Aldh1l1 PE=1 SV=3 912 1403 6.0E-57
sp|Q8R0Y6|AL1L1_MOUSE Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus GN=Aldh1l1 PE=1 SV=1 912 1403 1.0E-56
sp|Q3SY69|AL1L2_HUMAN Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L2 PE=1 SV=2 875 1403 1.0E-56
sp|P25526|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) GN=gabD PE=1 SV=1 924 1401 2.0E-56
sp|Q8K009|AL1L2_MOUSE Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus GN=Aldh1l2 PE=1 SV=2 912 1403 4.0E-56
sp|Q9FDS1|ALD1_ACISP Long-chain-aldehyde dehydrogenase OS=Acinetobacter sp. GN=ald1 PE=1 SV=1 909 1404 4.0E-56
sp|Q9I6M5|DAVD_PSEAE Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davD PE=1 SV=1 924 1390 4.0E-56
sp|Q92YD2|BETB2_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 2 OS=Rhizobium meliloti (strain 1021) GN=betB2 PE=3 SV=2 924 1402 4.0E-56
sp|P42329|ALDH_GEOSE Aldehyde dehydrogenase, thermostable OS=Geobacillus stearothermophilus GN=aldHT PE=1 SV=1 927 1402 2.0E-55
sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA2 PE=1 SV=2 903 1401 4.0E-55
sp|Q9KWS5|AMNC_PSESP 2-aminomuconic 6-semialdehyde dehydrogenase OS=Pseudomonas sp. GN=amnC PE=1 SV=1 933 1401 5.0E-55
sp|Q9UTM8|SSDH2_SCHPO Putative succinate-semialdehyde dehydrogenase C139.05 [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.05 PE=3 SV=1 924 1399 2.0E-54
sp|Q9HK01|GADH_THEAC D-glyceraldehyde dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0809 PE=1 SV=1 915 1404 4.0E-54
sp|O06478|ALDH5_BACSU Putative aldehyde dehydrogenase YfmT OS=Bacillus subtilis (strain 168) GN=yfmT PE=2 SV=1 909 1403 6.0E-54
sp|Q8BWF0|SSDH_MOUSE Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh5a1 PE=1 SV=1 915 1399 8.0E-53
sp|P94428|GABD_BACSU Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Bacillus subtilis (strain 168) GN=gabD PE=1 SV=1 928 1401 1.0E-52
sp|O75891|AL1L1_HUMAN Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L1 PE=1 SV=2 961 1403 2.0E-52
sp|Q5RFM9|AL1L1_PONAB Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Pongo abelii GN=ALDH1L1 PE=2 SV=1 961 1403 3.0E-52
sp|P52476|AL1B1_BOVIN Aldehyde dehydrogenase X, mitochondrial (Fragment) OS=Bos taurus GN=ALDH1B1 PE=2 SV=2 904 1402 5.0E-52
sp|P0A390|NAHF_PSEU8 Salicylaldehyde dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxF PE=3 SV=1 933 1397 6.0E-52
sp|P0A391|NAHF_PSEPU Salicylaldehyde dehydrogenase OS=Pseudomonas putida GN=nahF PE=3 SV=1 933 1397 6.0E-52
sp|P55653|GABD_RHISN Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Rhizobium sp. (strain NGR234) GN=gabD PE=3 SV=1 932 1390 1.0E-51
sp|P43503|XYLC_PSEPU Benzaldehyde dehydrogenase [NAD(+)] OS=Pseudomonas putida GN=xylC PE=1 SV=1 915 1372 1.0E-51
sp|P51650|SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh5a1 PE=1 SV=2 915 1399 2.0E-51
sp|P25553|ALDA_ECOLI Lactaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=aldA PE=1 SV=2 912 1399 3.0E-51
sp|P9WNX9|GABD1_MYCTU Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD1 PE=1 SV=1 932 1399 5.0E-51
sp|P9WNX8|GABD1_MYCTO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD1 PE=3 SV=1 932 1399 5.0E-51
sp|A5TYV9|GABD1_MYCTA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD1 PE=3 SV=2 932 1399 5.0E-51
sp|A1KF54|GABD1_MYCBP Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD1 PE=3 SV=2 932 1399 5.0E-51
sp|Q7U2I0|GABD1_MYCBO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD1 PE=3 SV=2 932 1399 5.0E-51
sp|Q9US47|SSDH1_SCHPO Putative succinate-semialdehyde dehydrogenase C1002.12c [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.12c PE=3 SV=2 892 1402 8.0E-51
sp|O69763|VDH_PSEFL Vanillin dehydrogenase OS=Pseudomonas fluorescens GN=vdh PE=3 SV=1 1045 1397 3.0E-50
sp|P94358|ALDY_BACSU Uncharacterized aldehyde dehydrogenase AldY OS=Bacillus subtilis (strain 168) GN=aldY PE=1 SV=1 906 1382 2.0E-49
sp|O32507|GABD_DEIRA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ssdA PE=3 SV=1 934 1397 2.0E-49
sp|O05619|VDH_PSEUH Vanillin dehydrogenase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=vdh PE=1 SV=1 969 1383 3.0E-49
sp|A0R4Q0|GABD2_MYCS2 Putative succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gabD2 PE=3 SV=1 966 1399 3.0E-49
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 606 902 4.0E-49
sp|Q1JUP4|KGSDH_AZOBR Alpha-ketoglutaric semialdehyde dehydrogenase OS=Azospirillum brasilense GN=araE PE=1 SV=1 915 1401 4.0E-49
sp|Q8GAI8|SSDH_ARTNI Succinate-semialdehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=sad PE=1 SV=1 965 1399 9.0E-49
sp|D4GP41|KGSDH_HALVD Alpha-ketoglutarate semialdehyde dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0039 PE=1 SV=1 924 1403 9.0E-49
sp|Q79EM7|PHDK_NOCSK 2-formylbenzoate dehydrogenase OS=Nocardioides sp. (strain KP7) GN=phdK PE=1 SV=1 929 1401 9.0E-49
sp|P9WNX7|GABD2_MYCTU Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD2 PE=1 SV=1 966 1399 1.0E-47
sp|P9WNX6|GABD2_MYCTO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD2 PE=3 SV=1 966 1399 1.0E-47
sp|A5U390|GABD2_MYCTA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD2 PE=3 SV=1 966 1399 1.0E-47
sp|A1KJE8|GABD2_MYCBP Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD2 PE=3 SV=1 966 1399 1.0E-47
sp|Q7TZP3|GABD2_MYCBO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD2 PE=3 SV=1 966 1399 1.0E-47
sp|Q97UA1|KGSDH_SULSO 2,5-dioxopentanoate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aldhT PE=1 SV=1 909 1399 1.0E-47
sp|A8Z3F5|ROCA_STAAT 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|Q6GDP4|ROCA_STAAR 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|P99076|ROCA_STAAN 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=rocA PE=1 SV=1 909 1361 2.0E-46
sp|P63939|ROCA_STAAM 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|A6QK44|ROCA_STAAE 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Newman) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|Q5HCZ6|ROCA_STAAC 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|Q2YWA6|ROCA_STAAB 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|A5IVY0|ROCA_STAA9 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain JH9) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|Q2FV67|ROCA_STAA8 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|Q2FDV3|ROCA_STAA3 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|A6U4T5|ROCA_STAA2 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain JH1) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|A7X6R7|ROCA_STAA1 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rocA PE=3 SV=1 909 1361 2.0E-46
sp|H1ZV37|GEOB_CASDE Geranial dehydrogenase OS=Castellaniella defragrans GN=geoB PE=1 SV=1 930 1399 2.0E-46
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 635 902 2.0E-46
sp|A0QMB9|GABD1_MYCA1 Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium avium (strain 104) GN=gabD1 PE=3 SV=1 932 1384 2.0E-46
sp|Q8GAK7|ALDH_ARTNI Aldehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=aldh PE=1 SV=1 932 1390 3.0E-46
sp|Q8NUR2|ROCA_STAAW 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=rocA PE=3 SV=1 909 1361 3.0E-46
sp|Q73TP5|GABD1_MYCPA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gabD1 PE=3 SV=1 932 1384 4.0E-46
sp|Q6G6C0|ROCA_STAAS 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=rocA PE=3 SV=1 909 1361 8.0E-46
sp|A6UVT6|LADH_META3 Lactaldehyde dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_1030 PE=3 SV=1 915 1402 9.0E-46
sp|A0PST9|GABD2_MYCUA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD2 PE=3 SV=1 965 1399 3.0E-45
sp|Q55585|GABD_SYNY3 Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gabD PE=3 SV=1 932 1399 5.0E-45
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 19 422 2.0E-44
sp|Q8CN04|ROCA_STAES 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rocA PE=3 SV=1 909 1361 2.0E-44
sp|Q5HL59|ROCA_STAEQ 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rocA PE=3 SV=1 909 1361 2.0E-44
sp|Q9AHG1|TSAD2_COMTE Putative 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD2 OS=Comamonas testosteroni GN=tsaD2 PE=5 SV=1 930 1397 2.0E-43
sp|O69497|GABD1_MYCLE Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium leprae (strain TN) GN=gabD1 PE=3 SV=1 932 1399 5.0E-43
sp|P39634|ROCA_BACSU 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus subtilis (strain 168) GN=rocA PE=2 SV=1 912 1386 1.0E-42
sp|P94682|TSAD1_COMTE 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD1 OS=Comamonas testosteroni GN=tsaD1 PE=1 SV=1 930 1397 3.0E-42
sp|H8ZPX2|SAPD_PSESP 3-succinoylsemialdehyde-pyridine dehydrogenase OS=Pseudomonas sp. GN=ald PE=1 SV=1 909 1400 6.0E-42
sp|A7GKJ4|ROCA_BACCN 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rocA PE=3 SV=1 909 1386 6.0E-42
sp|A9VRG6|ROCA_BACWK 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus weihenstephanensis (strain KBAB4) GN=rocA PE=3 SV=1 909 1390 6.0E-42
sp|Q4A0E7|ROCA_STAS1 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocA PE=3 SV=1 913 1361 1.0E-41
sp|P76149|SAD_ECOLI Succinate semialdehyde dehydrogenase [NAD(P)+] Sad OS=Escherichia coli (strain K12) GN=sad PE=1 SV=2 932 1384 2.0E-41
sp|Q49Z69|ALD1_STAS1 Putative aldehyde dehydrogenase SSP0762 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0762 PE=3 SV=1 905 1403 2.0E-41
sp|A0PN13|GABD1_MYCUA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD1 PE=3 SV=1 928 1401 3.0E-41
sp|C5D4J5|ROCA_GEOSW 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=rocA PE=3 SV=1 912 1390 3.0E-41
sp|Q81IP0|ROCA_BACCR 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rocA PE=3 SV=1 909 1390 8.0E-41
sp|B7H4V1|ROCA_BACC4 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain B4264) GN=rocA PE=3 SV=1 909 1390 8.0E-41
sp|B7IUW8|ROCA_BACC2 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain G9842) GN=rocA PE=3 SV=1 909 1390 8.0E-41
sp|P94391|ROCA2_BACSU 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=putC PE=2 SV=2 912 1361 1.0E-40
sp|Q65NN2|ROCA_BACLD 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rocA PE=1 SV=1 912 1361 1.0E-40
sp|Q59931|GAPN_STRMU NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gapN PE=1 SV=2 923 1402 1.0E-40
sp|O57693|GAPN_THETE NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Thermoproteus tenax GN=gapN PE=1 SV=1 911 1403 2.0E-40
sp|Q4L966|ROCA_STAHJ 1-pyrroline-5-carboxylate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rocA PE=3 SV=1 890 1361 3.0E-40
sp|Q8CNI5|ALD1_STAES Putative aldehyde dehydrogenase SE_1720 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1720 PE=3 SV=1 905 1399 3.0E-40
sp|Q5HMA0|ALD1_STAEQ Putative aldehyde dehydrogenase SERP1729 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1729 PE=3 SV=1 905 1399 3.0E-40
sp|P62028|ROCA_BACC1 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rocA PE=3 SV=1 909 1390 3.0E-40
sp|Q6HP91|ROCA_BACHK 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|Q63GS0|ROCA_BACCZ 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|B9J1L9|ROCA_BACCQ 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain Q1) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|B7HSW8|ROCA_BACC7 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain AH187) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|C1EV77|ROCA_BACC3 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain 03BB102) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|B7JM99|ROCA_BACC0 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus cereus (strain AH820) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|Q81ZF8|ROCA_BACAN 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|A0R909|ROCA_BACAH 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus thuringiensis (strain Al Hakam) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|C3L546|ROCA_BACAC 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|C3PBP4|ROCA_BACAA 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus anthracis (strain A0248) GN=rocA PE=3 SV=1 909 1390 4.0E-40
sp|Q58806|LADH_METJA Lactaldehyde dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1411 PE=1 SV=2 915 1402 5.0E-40
sp|Q7A4D8|ALD1_STAAN Putative aldehyde dehydrogenase SA1924 OS=Staphylococcus aureus (strain N315) GN=SA1924 PE=1 SV=1 909 1399 7.0E-40
sp|Q99SD6|ALD1_STAAM Putative aldehyde dehydrogenase SAV2122 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2122 PE=1 SV=1 909 1399 7.0E-40
sp|Q5HE78|ALD1_STAAC Putative aldehyde dehydrogenase SACOL2114 OS=Staphylococcus aureus (strain COL) GN=SACOL2114 PE=3 SV=1 909 1399 7.0E-40
sp|Q2FWD6|ALD1_STAA8 Putative aldehyde dehydrogenase SAOUHSC_02363 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02363 PE=3 SV=1 909 1399 7.0E-40
sp|Q2FF06|ALD1_STAA3 Putative aldehyde dehydrogenase SAUSA300_2076 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2076 PE=3 SV=1 909 1399 7.0E-40
sp|Q9K9B2|ROCA1_BACHD 1-pyrroline-5-carboxylate dehydrogenase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocA1 PE=1 SV=1 912 1361 8.0E-40
sp|Q3MSM3|SSDH_HYLLA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Hylobates lar GN=ALDH5A1 PE=2 SV=1 915 1399 8.0E-40
sp|Q1WIQ6|GAPN_ARATH NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana GN=ALDH11A3 PE=1 SV=2 910 1402 9.0E-40
sp|B7GFV3|ROCA_ANOFW 1-pyrroline-5-carboxylate dehydrogenase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rocA PE=3 SV=1 909 1386 2.0E-39
sp|Q3MSM4|SSDH_PANPA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan paniscus GN=ALDH5A1 PE=2 SV=1 915 1399 2.0E-39
sp|Q5L3K8|ROCA_GEOKA 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=rocA PE=3 SV=1 912 1390 3.0E-39
sp|Q3C1A6|GAPN_STREI NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus equinus GN=gapN PE=1 SV=1 912 1404 3.0E-39
sp|E1V7V8|DOEC_HALED Aspartate-semialdehyde dehydrogenase (Non-phosphorylating) OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeC PE=3 SV=1 915 1397 3.0E-39
sp|P51649|SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH5A1 PE=1 SV=2 915 1399 3.0E-39
sp|Q8NVG4|ALD1_STAAW Putative aldehyde dehydrogenase MW2046 OS=Staphylococcus aureus (strain MW2) GN=MW2046 PE=3 SV=1 909 1399 3.0E-39
sp|Q6G7I8|ALD1_STAAS Putative aldehyde dehydrogenase SAS2025 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2025 PE=3 SV=1 909 1399 3.0E-39
sp|Q6GEV3|ALD1_STAAR Putative aldehyde dehydrogenase SAR2210 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2210 PE=3 SV=1 909 1399 3.0E-39
sp|Q6A2H1|SSDH_GORGO Succinate-semialdehyde dehydrogenase, mitochondrial OS=Gorilla gorilla gorilla GN=ALDH5A1 PE=2 SV=1 915 1399 3.0E-39
sp|Q8ERF4|ROCA_OCEIH 1-pyrroline-5-carboxylate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rocA PE=3 SV=1 912 1361 4.0E-39
sp|Q6A2H2|SSDH_PONPY Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pongo pygmaeus GN=ALDH5A1 PE=2 SV=2 915 1399 5.0E-39
sp|Q6A2H0|SSDH_PANTR Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan troglodytes GN=ALDH5A1 PE=2 SV=1 915 1399 9.0E-39
sp|Q2YUN1|ALD1_STAAB Putative aldehyde dehydrogenase SAB2006c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2006c PE=3 SV=1 909 1399 9.0E-39
sp|A4IJP9|ROCA_GEOTN 1-pyrroline-5-carboxylate dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rocA PE=3 SV=1 912 1386 1.0E-38
sp|A8F9T1|ROCA_BACP2 1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus pumilus (strain SAFR-032) GN=rocA PE=3 SV=1 912 1361 2.0E-38
sp|A8FDV4|IOLA_BACP2 Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus pumilus (strain SAFR-032) GN=iolA PE=3 SV=1 930 1361 4.0E-38
sp|Q5WKZ1|IOLA1_BACSK Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Bacillus clausii (strain KSM-K16) GN=iolA1 PE=3 SV=1 932 1403 5.0E-38
sp|Q4L803|ALD1_STAHJ Putative aldehyde dehydrogenase SH0913 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0913 PE=3 SV=2 905 1399 5.0E-38
sp|P49419|AL7A1_HUMAN Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens GN=ALDH7A1 PE=1 SV=5 882 1405 5.0E-38
sp|Q8EMV4|IOLA2_OCEIH Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=iolA2 PE=3 SV=1 932 1361 6.0E-38
sp|A4IPB2|IOLA1_GEOTN Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolA1 PE=3 SV=2 915 1361 9.0E-38
sp|Q5KYR4|IOLA2_GEOKA Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Geobacillus kaustophilus (strain HTA426) GN=iolA2 PE=3 SV=2 915 1361 2.0E-37
sp|O52485|PUTA_ENTAE Bifunctional protein PutA OS=Enterobacter aerogenes GN=putA PE=3 SV=1 924 1386 2.0E-37
sp|Q9KAH5|IOLA_BACHD Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=iolA PE=3 SV=1 925 1361 2.0E-37
sp|A6VH72|LADH_METM7 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0731 PE=3 SV=1 1001 1402 9.0E-37
sp|P46562|AL7A1_CAEEL Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Caenorhabditis elegans GN=alh-9 PE=3 SV=2 925 1404 2.0E-36
sp|A6UQD0|LADH_METVS Lactaldehyde dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0796 PE=3 SV=1 1021 1402 2.0E-36
sp|Q8LK61|GAPN_WHEAT NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Triticum aestivum GN=GAPN PE=1 SV=2 910 1402 3.0E-36
sp|P09546|PUTA_ECOLI Bifunctional protein PutA OS=Escherichia coli (strain K12) GN=putA PE=1 SV=3 925 1386 3.0E-36
sp|Q9DBF1|AL7A1_MOUSE Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus GN=Aldh7a1 PE=1 SV=4 882 1404 4.0E-36
sp|Q65D00|IOLA2_BACLD Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=iolA2 PE=3 SV=1 932 1361 7.0E-36
sp|Q4V1F6|IOLA3_BACCZ Methylmalonate semialdehyde dehydrogenase [acylating] 3 OS=Bacillus cereus (strain ZK / E33L) GN=iolA3 PE=3 SV=1 930 1361 7.0E-36
sp|P93338|GAPN_NICPL NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Nicotiana plumbaginifolia GN=GAPN PE=2 SV=1 908 1402 1.0E-35
sp|Q9SNX8|GAPN_APIGR NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Apium graveolens PE=1 SV=1 908 1402 2.0E-35
sp|Q97U30|GAPN_SULSO NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gapN-3 PE=1 SV=1 1043 1404 2.0E-35
sp|P52713|MMSA_CAEEL Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Caenorhabditis elegans GN=alh-8 PE=3 SV=1 914 1361 3.0E-35
sp|Q6HIK3|IOLA2_BACHK Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=iolA2 PE=3 SV=1 930 1361 4.0E-35
sp|A0REB5|IOLA2_BACAH Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=iolA2 PE=3 SV=2 930 1361 4.0E-35
sp|Q64057|AL7A1_RAT Alpha-aminoadipic semialdehyde dehydrogenase OS=Rattus norvegicus GN=Aldh7a1 PE=1 SV=2 882 1406 5.0E-35
sp|Q81QB6|IOLA2_BACAN Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus anthracis GN=iolA2 PE=3 SV=1 930 1361 5.0E-35
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 1 439 5.0E-35
sp|Q9K5Z5|ROCA2_BACHD 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocA2 PE=3 SV=1 912 1361 6.0E-35
sp|Q0WSF1|AL221_ARATH Aldehyde dehydrogenase 22A1 OS=Arabidopsis thaliana GN=ALDH22A1 PE=2 SV=2 904 1400 6.0E-35
sp|Q2KJC9|AL7A1_BOVIN Alpha-aminoadipic semialdehyde dehydrogenase OS=Bos taurus GN=ALDH7A1 PE=2 SV=4 882 1404 8.0E-35
sp|P10503|PUTA_SALTY Bifunctional protein PutA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=putA PE=2 SV=4 924 1386 8.0E-35
sp|Q8Y9Y4|IOLA_LISMO Methylmalonate semialdehyde dehydrogenase [acylating] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=iolA PE=3 SV=1 932 1404 1.0E-34
sp|Q54I10|MMSA_DICDI Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Dictyostelium discoideum GN=mmsdh PE=3 SV=1 914 1361 1.0E-34
sp|A4FW36|LADH_METM5 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0090 PE=3 SV=1 1020 1402 1.0E-34
sp|P25795|AL7A1_PEA Aldehyde dehydrogenase family 7 member A1 OS=Pisum sativum PE=1 SV=3 915 1404 2.0E-34
sp|Q43272|GAPN_MAIZE NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Zea mays GN=GPN1 PE=2 SV=1 910 1402 2.0E-34
sp|P81406|GAPN_PEA NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Pisum sativum GN=GAPN PE=1 SV=1 910 1402 2.0E-34
sp|B8DCT8|IOLA_LISMH Methylmalonate semialdehyde dehydrogenase [acylating] OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=iolA PE=3 SV=1 932 1404 2.0E-34
sp|A7GPH3|IOLA_BACCN Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=iolA PE=3 SV=1 930 1363 2.0E-34
sp|Q17M80|MMSA_AEDAE Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Aedes aegypti GN=AAEL001134 PE=3 SV=1 928 1361 2.0E-34
sp|P42412|IOLA_BACSU Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus subtilis (strain 168) GN=iolA PE=1 SV=1 932 1361 3.0E-34
sp|Q39I25|ASTD_BURL3 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=astD PE=3 SV=1 911 1375 3.0E-34
sp|Q9EQ20|MMSA_MOUSE Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus GN=Aldh6a1 PE=1 SV=1 928 1361 3.0E-34
sp|Q141D3|ASTD_BURXL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=astD PE=3 SV=2 914 1392 3.0E-34
sp|Q63B74|IOLA2_BACCZ Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus cereus (strain ZK / E33L) GN=iolA2 PE=3 SV=1 930 1361 4.0E-34
sp|Q723T1|IOLA_LISMF Methylmalonate semialdehyde dehydrogenase [acylating] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=iolA PE=3 SV=1 932 1404 4.0E-34
sp|C1KZ99|IOLA_LISMC Methylmalonate semialdehyde dehydrogenase [acylating] OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=iolA PE=3 SV=1 932 1404 5.0E-34
sp|A7ZAI1|IOLA_BACMF Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolA PE=3 SV=1 932 1361 5.0E-34
sp|A0K608|ASTD_BURCH N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=astD PE=3 SV=1 911 1375 7.0E-34
sp|Q1BXP1|ASTD_BURCA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=astD PE=3 SV=1 911 1375 7.0E-34
sp|A4JCW0|ASTD_BURVG N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=astD PE=3 SV=1 911 1375 9.0E-34
sp|Q29491|ALDH2_MACPR Aldehyde dehydrogenase, cytosolic 2 (Fragment) OS=Macroscelides proboscideus PE=2 SV=1 1149 1399 9.0E-34
sp|A7BJC4|IOLA_BACNA Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus subtilis subsp. natto GN=iolA PE=3 SV=2 932 1361 1.0E-33
sp|Q02253|MMSA_RAT Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Rattus norvegicus GN=Aldh6a1 PE=1 SV=1 928 1361 1.0E-33
sp|Q07536|MMSA_BOVIN Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Bos taurus GN=ALDH6A1 PE=1 SV=1 928 1361 1.0E-33
sp|Q92EQ7|IOLA_LISIN Methylmalonate semialdehyde dehydrogenase [acylating] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iolA PE=3 SV=1 932 1404 1.0E-33
sp|Q02252|MMSA_HUMAN Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens GN=ALDH6A1 PE=1 SV=2 928 1361 1.0E-33
sp|Q6LX65|LADH_METMP Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1487 PE=3 SV=1 1020 1402 2.0E-33
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 7 426 2.0E-33
sp|Q2BN77|SAFD_NEPCE Sulfoacetaldehyde dehydrogenase OS=Neptuniibacter caesariensis GN=safD PE=1 SV=1 974 1401 2.0E-33
sp|Q9ZPB7|AL7A1_MALDO Aldehyde dehydrogenase family 7 member A1 OS=Malus domestica PE=1 SV=3 915 1404 3.0E-33
sp|B1JYT5|ASTD_BURCC N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=astD PE=3 SV=1 911 1375 4.0E-33
sp|B4ECZ8|ASTD_BURCJ N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=astD PE=3 SV=1 911 1375 5.0E-33
sp|Q0BGV0|ASTD_BURCM N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=astD PE=3 SV=1 911 1375 6.0E-33
sp|Q0WM29|MMSA_ARATH Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Arabidopsis thaliana GN=ALDH6B2 PE=2 SV=2 928 1361 7.0E-33
sp|Q7QC84|MMSA_ANOGA Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Anopheles gambiae GN=AGAP002499 PE=3 SV=2 928 1361 9.0E-33
sp|Q5L025|IOLA1_GEOKA Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Geobacillus kaustophilus (strain HTA426) GN=iolA1 PE=3 SV=1 928 1361 1.0E-32
sp|A5YBJ3|IOLA_LACCA Methylmalonate semialdehyde dehydrogenase [acylating] OS=Lactobacillus casei GN=iolA PE=3 SV=1 930 1361 1.0E-32
sp|B1YW19|ASTD_BURA4 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=astD PE=3 SV=1 911 1375 2.0E-32
sp|Q9SYG7|AL7B4_ARATH Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana GN=ALDH7B4 PE=2 SV=3 924 1405 2.0E-32
sp|B6EML5|ASTD_ALISL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=astD PE=3 SV=1 915 1361 3.0E-32
sp|Q2SXN9|ASTD_BURTA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=astD PE=1 SV=1 911 1374 4.0E-32
sp|A3NBM7|ASTD_BURP6 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=astD PE=3 SV=1 911 1374 4.0E-32
sp|A1V675|ASTD_BURMS N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=astD PE=3 SV=1 911 1374 4.0E-32
sp|Q62LN5|ASTD_BURMA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=astD PE=3 SV=1 911 1374 4.0E-32
sp|Q65IX1|IOLA1_BACLD Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=iolA1 PE=3 SV=1 932 1363 5.0E-32
sp|Q5KYK0|IOLA3_GEOKA Methylmalonate semialdehyde dehydrogenase [acylating] 3 OS=Geobacillus kaustophilus (strain HTA426) GN=iolA3 PE=3 SV=2 921 1403 5.0E-32
sp|A9VF06|IOLA1_BACWK Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=iolA1 PE=3 SV=1 930 1363 6.0E-32
sp|A9VMS6|IOLA2_BACWK Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=iolA2 PE=3 SV=2 930 1361 6.0E-32
sp|Q7N2G9|ASTD_PHOLL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=astD PE=3 SV=1 915 1374 6.0E-32
sp|A9AD19|ASTD_BURM1 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=astD PE=3 SV=1 911 1375 9.0E-32
sp|Q41247|AL7A1_BRANA Aldehyde dehydrogenase family 7 member A1 OS=Brassica napus GN=BTG-26 PE=1 SV=3 923 1393 1.0E-31
sp|Q94688|ALDH9_POLMI Aldehyde dehydrogenase 9 (Fragment) OS=Polyandrocarpa misakiensis GN=ALDH9 PE=3 SV=1 1060 1290 2.0E-31
sp|Q81DR5|IOLA_BACCR Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=iolA PE=3 SV=1 930 1363 2.0E-31
sp|Q63SD7|ASTD_BURPS N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=astD PE=3 SV=1 911 1374 2.0E-31
sp|Q3JQC6|ASTD_BURP1 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=astD PE=3 SV=1 911 1374 2.0E-31
sp|A3NXG2|ASTD_BURP0 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=astD PE=3 SV=1 911 1374 2.0E-31
sp|B7H597|IOLA_BACC4 Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus cereus (strain B4264) GN=iolA PE=3 SV=1 930 1363 2.0E-31
sp|B7IW48|IOLA_BACC2 Methylmalonate semialdehyde dehydrogenase [acylating] OS=Bacillus cereus (strain G9842) GN=iolA PE=3 SV=1 930 1363 2.0E-31
sp|Q5QVX3|ASTD_IDILO N-succinylglutamate 5-semialdehyde dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=astD PE=3 SV=1 915 1374 3.0E-31
sp|Q2G9T9|ASTD_NOVAD N-succinylglutamate 5-semialdehyde dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=astD PE=3 SV=1 970 1374 3.0E-31
sp|P33008|ALDH_PSESP Probable aldehyde dehydrogenase OS=Pseudomonas sp. GN=terPE PE=3 SV=1 928 1402 4.0E-31
sp|Q9P7K9|YOSF_SCHPO Putative aldehyde dehydrogenase-like protein C21C3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.15c PE=3 SV=1 933 1399 6.0E-31
sp|Q488Y0|ASTD_COLP3 N-succinylglutamate 5-semialdehyde dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=astD PE=3 SV=1 915 1374 6.0E-31
sp|P12693|ALDH_PSEOL Aldehyde dehydrogenase OS=Pseudomonas oleovorans GN=alkH PE=2 SV=1 1047 1402 9.0E-31
sp|A4IPF5|IOLA2_GEOTN Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolA2 PE=3 SV=2 921 1403 9.0E-31
sp|A1U5W8|ASTD_MARHV N-succinylglutamate 5-semialdehyde dehydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=astD PE=3 SV=1 914 1392 2.0E-30
sp|Q63BL0|IOLA1_BACCZ Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Bacillus cereus (strain ZK / E33L) GN=iolA1 PE=3 SV=1 930 1363 2.0E-30
sp|A0RDW1|IOLA1_BACAH Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=iolA1 PE=3 SV=1 930 1363 2.0E-30
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 423 604 1.0E-13
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 422 562 4.0E-13
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 423 583 6.0E-11
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 423 566 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0019346 transsulfuration Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0044237 cellular metabolic process No
GO:0070279 vitamin B6 binding No
GO:0043436 oxoacid metabolic process No
GO:0009092 homoserine metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006534 cysteine metabolic process No
GO:0019842 vitamin binding No
GO:0019752 carboxylic acid metabolic process No
GO:0051234 establishment of localization No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0005215 transporter activity No
GO:0006790 sulfur compound metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0009069 serine family amino acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0000096 sulfur amino acid metabolic process No
GO:0005575 cellular_component No
GO:0050667 homocysteine metabolic process No
GO:0006082 organic acid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 59 78 19
3 80 102 22
4 117 139 22
5 146 168 22
6 197 219 22
7 245 267 22
8 296 318 22
9 323 345 22
10 365 387 22
11 400 417 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3382
MDPNSSDEAHLAALGLRSELRRSFSTLSMLGLAFAVLNTWTAVSASLPVSLTSGGSTSIIWVSWPSWMPLLSWIN
GWIAIAGWVALVATNALLSSQLILGIVSLLHPSYETQRWHQFLIYTALTILSFLVNAFLNSLLPLIYRGAFAWSI
GGFVVACVVMLACASPDFHSAEFVFGQFINRTGWPDAVAWLLGGPKIMILCVIIGTVTGAIFLAVLLSVSGDIES
VISSSAGPLLQILVNATGNAAGAICLLMLPLVCLVFALLSVMTTSSRIIYAFARDGGLPASTVFVRVHPKLGQPL
NALALSSAVVVLFGLIFLASSSAFNAIMSSSVVALDLSYAMPIAIRCLRGRSPLPQGQWKLSPLLGWTVDTVSLA
YITLTTFLFLLPPSRPVTGTNMNYCIVAFAVVIIVSVLQWLVDGRKNVSLPTWRDTLGWAHRDPQLLSQLDAGYP
RFFVPHLVRALAARLLEWTRQNHQPVPASDISAMLFPSSIMATSCERYLRDRSDDSSGAVITSLAIRIDGSFKTR
DETCGEDVLMVLHPETLAAEAKAFWQHTGFGISSRFAAHWLKTAPFLGGKTEPLPLKEAHDAGLALSSRIAGLYS
TGPDHVFLYHTGMSAMAHAASAIRRLSGRAEKGFRVVVFGFPYVDTFKVLSKVYGFDCVLYGHASATELDELEAG
LESGSRLDVVVTEFPGNPLLRSVDLARLNALSRKHGFYIIIDDTIGTAVNLDLSSSYDVVCTSLTKMFSGACNVM
GGSIVLGPRCQHRDSLRAALSDLYEDTYFPLDVIVMNTNSVGFESRVQLASRNAERVVDRLRHHRVVETVYYPRG
SPTQHLYDNFRRAGAGYGYLLSIEFVEPAAATAFFDALDVAKGPSLGTNFTLCCAYTLLAHASELDWAAEYGVRE
HLQPNMPQQDLYPLWVNGRDTPGNGPVIPIEDPSTSHVFAHCQSASPSDVEAAIQLAHDTFQSGTWSRAPRHTRA
LVLDRAADLLTAELPALIQLEVRQTGRALREMTAQLPTLRAWFRYYAAVLRTEQRSLLPTTGSLHNWIERIPLGV
VVQLTPYNHPLLIAVKKLAPALAAGNSVLLKPSELAPLTSLRLGPVLKAAGLPDGVLAVLPGLGSVTGAALVGNR
LVRKVDLTGGTAAGREMGAVVGRNLGRFTAELGGKAPLVVFDSACVEAAVNGIAFGAFVASGQTCVAATRVIVHV
SLLADVEEKLRIKSESIVRRMGSPSNPDSSMGSLISARQLDIVDALVQEAVSGPDPGARLVCGGRRMTNISQLDG
TDFSKGHFYPPTVLSSTSGRSITATRLWREEAFGPAVVLVGFDTEAEAVQLANDSELGLGAAIWTRDLSQAFRVT
GLINCGIVWVNTHHRNDPSSPWGGTTNASGVGSENGLEAYYSYTSTKSIIVNYADAQQSLLDDDWFGEGAEGVRY
G*
Coding >Ophun1|3382
ATGGATCCCAACAGCAGTGATGAAGCTCACCTCGCCGCTCTCGGCCTCCGCTCCGAACTCCGCCGGTCCTTCTCA
ACGCTGTCCATGCTCGGCCTCGCCTTTGCCGTCCTCAATACCTGGACGGCTGTATCGGCGAGCCTGCCCGTAAGC
CTCACTTCCGGAGGCAGCACCAGCATCATCTGGGTCTCGTGGCCATCATGGATGCCTCTCCTATCGTGGATCAAC
GGCTGGATCGCCATCGCCGGCTGGGTCGCCCTGGTAGCCACCAACGCACTGCTATCAAGCCAGCTGATCCTCGGC
ATCGTCTCACTGCTACATCCCAGCTACGAGACCCAACGATGGCACCAGTTCCTCATCTACACCGCCCTGACCATC
CTCTCCTTTCTCGTCAACGCCTTTCTCAACTCGCTGCTGCCGCTCATCTACCGCGGGGCTTTTGCCTGGTCCATC
GGCGGCTTCGTCGTTGCCTGTGTGGTTATGCTGGCCTGTGCATCTCCGGACTTTCACTCGGCTGAGTTTGTCTTT
GGGCAGTTTATCAATCGGACGGGATGGCCTGATGCCGTCGCCTGGCTTTTGGGGGGCCCCAAGATCATGATCCTC
TGCGTCATCATCGGCACCGTAACGGGCGCCATCTTCCTCGCCGTCCTTCTCTCCGTTTCCGGAGACATTGAATCC
GTCATTAGCTCGAGCGCCGGCCCGCTGCTGCAGATCTTGGTCAACGCCACTGGCAACGCGGCCGGGGCCATCTGT
CTGCTCATGCTGCCTCTGGTCTGCCTCGTCTTCGCTCTGTTGAGTGTCATGACGACGAGCAGCCGGATCATCTAT
GCCTTTGCGCGTGATGGCGGTCTTCCAGCCTCGACCGTCTTCGTCAGAGTCCATCCCAAGCTCGGTCAGCCACTC
AACGCCCTGGCCCTCAGCTCAGCCGTCGTCGTTCTGTTCGGCCTGATCTTTCTGGCTTCATCGAGTGCCTTCAAC
GCCATCATGTCGTCCTCGGTCGTCGCCCTCGACCTCTCGTACGCCATGCCCATCGCCATACGCTGTCTCCGAGGC
CGCAGTCCGCTCCCTCAGGGGCAATGGAAGCTGTCCCCCCTTCTGGGATGGACCGTCGACACGGTCTCGCTGGCC
TATATAACGCTGACGACCTTTTTGTTCCTACTGCCGCCCAGCCGGCCGGTAACGGGGACCAACATGAATTACTGC
ATCGTCGCCTTTGCCGTCGTCATCATCGTCTCTGTTCTTCAATGGCTCGTCGACGGCCGGAAGAACGTCTCGCTC
CCAACATGGCGAGATACCCTGGGCTGGGCCCATCGAGACCCTCAGCTTCTCTCCCAGCTCGACGCCGGCTATCCT
CGCTTCTTCGTCCCTCATCTCGTCCGCGCTCTGGCCGCTAGGTTGCTGGAATGGACAAGACAGAATCATCAGCCC
GTGCCAGCTTCCGACATCTCGGCCATGCTCTTCCCCAGCAGTATCATGGCCACATCCTGCGAGCGCTACTTAAGA
GACCGATCCGACGACTCTTCAGGGGCTGTCATAACCTCCCTCGCCATCCGGATCGACGGCTCCTTCAAAACCCGA
GACGAAACATGCGGAGAGGACGTCTTGATGGTGCTTCATCCGGAGACGCTCGCAGCCGAGGCAAAGGCCTTCTGG
CAACACACGGGCTTCGGCATCTCGAGCCGCTTCGCCGCCCACTGGTTGAAGACGGCCCCCTTTCTCGGAGGGAAG
ACCGAGCCGCTACCGCTAAAGGAAGCTCACGATGCCGGCCTCGCTCTCAGCAGCCGTATCGCCGGCCTCTACTCT
ACCGGTCCGGACCATGTCTTTCTCTACCATACGGGCATGTCGGCCATGGCCCACGCCGCCTCGGCCATCCGTCGG
CTCAGCGGCCGGGCGGAAAAGGGCTTCCGGGTTGTTGTCTTCGGGTTTCCCTACGTCGATACCTTCAAGGTGCTC
AGCAAGGTATACGGCTTCGACTGCGTGCTGTACGGCCACGCCTCGGCCACAGAACTCGACGAGCTGGAAGCTGGA
TTGGAGTCTGGCTCGCGTCTAGACGTCGTCGTCACTGAGTTTCCGGGTAACCCCCTACTTCGATCCGTCGATCTG
GCGAGACTGAATGCGCTCTCGCGGAAGCACGGCTTCTACATCATCATCGACGACACCATCGGAACTGCCGTCAAC
CTCGATCTCAGCTCATCCTACGACGTCGTCTGTACGAGCCTGACCAAGATGTTTAGCGGCGCCTGCAACGTCATG
GGCGGGAGCATCGTCCTCGGTCCCCGTTGCCAGCATCGTGACTCCCTACGAGCAGCCCTCTCGGACCTTTACGAG
GACACGTACTTTCCCCTCGACGTCATCGTCATGAACACCAACAGCGTCGGCTTCGAGAGCCGCGTCCAGCTGGCG
AGCCGCAACGCGGAAAGAGTCGTCGACCGCCTTAGACATCACAGGGTCGTCGAGACGGTCTACTATCCGCGCGGC
AGCCCGACACAGCACCTGTACGACAACTTCAGACGGGCCGGAGCTGGATACGGCTACCTGCTTTCCATCGAGTTC
GTCGAGCCGGCCGCGGCCACGGCCTTTTTCGATGCCCTCGACGTGGCCAAGGGGCCGAGCCTGGGCACCAACTTT
ACCCTCTGCTGCGCCTATACGTTGCTGGCGCACGCCTCGGAGCTGGACTGGGCGGCTGAGTATGGCGTGAGGGAG
CATTTGCAACCAAACATGCCCCAACAAGACCTCTATCCCCTCTGGGTCAACGGACGAGACACGCCAGGCAACGGC
CCAGTCATCCCCATCGAGGACCCGTCCACCAGCCACGTCTTCGCCCACTGCCAATCCGCCTCACCCTCCGACGTC
GAAGCCGCCATCCAGCTCGCCCACGACACCTTCCAGTCCGGAACATGGTCACGAGCCCCCCGCCACACACGAGCC
CTCGTCCTCGACCGCGCAGCCGACCTCCTCACCGCCGAGCTCCCGGCCCTCATCCAGCTCGAGGTCCGGCAGACG
GGCCGGGCTCTCCGGGAGATGACGGCCCAGCTTCCGACGCTGCGTGCCTGGTTCCGATACTATGCCGCCGTTCTC
CGCACCGAGCAGCGATCTCTACTGCCGACGACGGGCTCGCTGCACAACTGGATAGAGCGCATCCCTCTCGGTGTC
GTCGTCCAGCTGACGCCCTATAACCACCCTCTCCTCATCGCCGTCAAGAAGCTGGCCCCTGCACTGGCAGCCGGC
AACAGCGTGCTCCTCAAACCCAGCGAGCTGGCACCTCTAACCAGCCTCCGTCTCGGCCCCGTGCTCAAAGCCGCG
GGTCTTCCGGACGGCGTACTGGCCGTTCTCCCGGGCCTCGGCTCCGTGACCGGCGCGGCGCTGGTGGGGAACCGG
CTCGTCCGAAAGGTGGATCTCACGGGCGGAACGGCGGCGGGGCGGGAGATGGGCGCTGTGGTCGGTCGGAATCTG
GGCCGATTTACGGCTGAGTTGGGGGGCAAGGCTCCGCTGGTTGTCTTTGACTCGGCTTGCGTGGAGGCTGCTGTC
AATGGCATCGCTTTTGGCGCGTTTGTGGCTTCGGGTCAGACTTGTGTTGCGGCTACGCGTGTTATTGTTCATGTC
AGTTTGCTTGCAGACGTGGAGGAGAAGCTGAGGATCAAAAGCGAGTCCATCGTCAGACGAATGGGCTCACCTTCG
AACCCGGATTCATCCATGGGAAGTCTCATCTCCGCCCGTCAGCTCGATATAGTCGATGCTCTCGTACAAGAGGCA
GTCTCCGGTCCGGATCCCGGGGCCCGGCTGGTCTGCGGCGGACGGCGGATGACGAACATTTCTCAGCTGGACGGC
ACAGACTTCTCTAAGGGGCACTTCTACCCGCCTACAGTTCTATCGTCGACATCCGGCCGCAGCATCACGGCCACC
CGTCTCTGGCGCGAAGAGGCCTTTGGTCCGGCCGTCGTTCTCGTGGGCTTTGACACCGAGGCTGAGGCCGTTCAG
CTGGCCAACGATAGCGAGCTGGGCCTTGGAGCTGCCATCTGGACGCGAGACCTTTCCCAGGCGTTTCGTGTGACG
GGGCTCATCAACTGCGGCATCGTTTGGGTCAACACCCATCACCGGAATGATCCCAGCAGTCCCTGGGGGGGAACG
ACCAATGCCAGCGGTGTTGGGAGCGAGAACGGGCTGGAAGCCTATTACTCTTACACGTCGACCAAGAGCATCATC
GTCAACTACGCAGACGCTCAGCAGTCTCTCCTCGACGATGACTGGTTCGGGGAGGGGGCCGAGGGTGTTCGGTAC
GGCTAA
Transcript >Ophun1|3382
ATGGATCCCAACAGCAGTGATGAAGCTCACCTCGCCGCTCTCGGCCTCCGCTCCGAACTCCGCCGGTCCTTCTCA
ACGCTGTCCATGCTCGGCCTCGCCTTTGCCGTCCTCAATACCTGGACGGCTGTATCGGCGAGCCTGCCCGTAAGC
CTCACTTCCGGAGGCAGCACCAGCATCATCTGGGTCTCGTGGCCATCATGGATGCCTCTCCTATCGTGGATCAAC
GGCTGGATCGCCATCGCCGGCTGGGTCGCCCTGGTAGCCACCAACGCACTGCTATCAAGCCAGCTGATCCTCGGC
ATCGTCTCACTGCTACATCCCAGCTACGAGACCCAACGATGGCACCAGTTCCTCATCTACACCGCCCTGACCATC
CTCTCCTTTCTCGTCAACGCCTTTCTCAACTCGCTGCTGCCGCTCATCTACCGCGGGGCTTTTGCCTGGTCCATC
GGCGGCTTCGTCGTTGCCTGTGTGGTTATGCTGGCCTGTGCATCTCCGGACTTTCACTCGGCTGAGTTTGTCTTT
GGGCAGTTTATCAATCGGACGGGATGGCCTGATGCCGTCGCCTGGCTTTTGGGGGGCCCCAAGATCATGATCCTC
TGCGTCATCATCGGCACCGTAACGGGCGCCATCTTCCTCGCCGTCCTTCTCTCCGTTTCCGGAGACATTGAATCC
GTCATTAGCTCGAGCGCCGGCCCGCTGCTGCAGATCTTGGTCAACGCCACTGGCAACGCGGCCGGGGCCATCTGT
CTGCTCATGCTGCCTCTGGTCTGCCTCGTCTTCGCTCTGTTGAGTGTCATGACGACGAGCAGCCGGATCATCTAT
GCCTTTGCGCGTGATGGCGGTCTTCCAGCCTCGACCGTCTTCGTCAGAGTCCATCCCAAGCTCGGTCAGCCACTC
AACGCCCTGGCCCTCAGCTCAGCCGTCGTCGTTCTGTTCGGCCTGATCTTTCTGGCTTCATCGAGTGCCTTCAAC
GCCATCATGTCGTCCTCGGTCGTCGCCCTCGACCTCTCGTACGCCATGCCCATCGCCATACGCTGTCTCCGAGGC
CGCAGTCCGCTCCCTCAGGGGCAATGGAAGCTGTCCCCCCTTCTGGGATGGACCGTCGACACGGTCTCGCTGGCC
TATATAACGCTGACGACCTTTTTGTTCCTACTGCCGCCCAGCCGGCCGGTAACGGGGACCAACATGAATTACTGC
ATCGTCGCCTTTGCCGTCGTCATCATCGTCTCTGTTCTTCAATGGCTCGTCGACGGCCGGAAGAACGTCTCGCTC
CCAACATGGCGAGATACCCTGGGCTGGGCCCATCGAGACCCTCAGCTTCTCTCCCAGCTCGACGCCGGCTATCCT
CGCTTCTTCGTCCCTCATCTCGTCCGCGCTCTGGCCGCTAGGTTGCTGGAATGGACAAGACAGAATCATCAGCCC
GTGCCAGCTTCCGACATCTCGGCCATGCTCTTCCCCAGCAGTATCATGGCCACATCCTGCGAGCGCTACTTAAGA
GACCGATCCGACGACTCTTCAGGGGCTGTCATAACCTCCCTCGCCATCCGGATCGACGGCTCCTTCAAAACCCGA
GACGAAACATGCGGAGAGGACGTCTTGATGGTGCTTCATCCGGAGACGCTCGCAGCCGAGGCAAAGGCCTTCTGG
CAACACACGGGCTTCGGCATCTCGAGCCGCTTCGCCGCCCACTGGTTGAAGACGGCCCCCTTTCTCGGAGGGAAG
ACCGAGCCGCTACCGCTAAAGGAAGCTCACGATGCCGGCCTCGCTCTCAGCAGCCGTATCGCCGGCCTCTACTCT
ACCGGTCCGGACCATGTCTTTCTCTACCATACGGGCATGTCGGCCATGGCCCACGCCGCCTCGGCCATCCGTCGG
CTCAGCGGCCGGGCGGAAAAGGGCTTCCGGGTTGTTGTCTTCGGGTTTCCCTACGTCGATACCTTCAAGGTGCTC
AGCAAGGTATACGGCTTCGACTGCGTGCTGTACGGCCACGCCTCGGCCACAGAACTCGACGAGCTGGAAGCTGGA
TTGGAGTCTGGCTCGCGTCTAGACGTCGTCGTCACTGAGTTTCCGGGTAACCCCCTACTTCGATCCGTCGATCTG
GCGAGACTGAATGCGCTCTCGCGGAAGCACGGCTTCTACATCATCATCGACGACACCATCGGAACTGCCGTCAAC
CTCGATCTCAGCTCATCCTACGACGTCGTCTGTACGAGCCTGACCAAGATGTTTAGCGGCGCCTGCAACGTCATG
GGCGGGAGCATCGTCCTCGGTCCCCGTTGCCAGCATCGTGACTCCCTACGAGCAGCCCTCTCGGACCTTTACGAG
GACACGTACTTTCCCCTCGACGTCATCGTCATGAACACCAACAGCGTCGGCTTCGAGAGCCGCGTCCAGCTGGCG
AGCCGCAACGCGGAAAGAGTCGTCGACCGCCTTAGACATCACAGGGTCGTCGAGACGGTCTACTATCCGCGCGGC
AGCCCGACACAGCACCTGTACGACAACTTCAGACGGGCCGGAGCTGGATACGGCTACCTGCTTTCCATCGAGTTC
GTCGAGCCGGCCGCGGCCACGGCCTTTTTCGATGCCCTCGACGTGGCCAAGGGGCCGAGCCTGGGCACCAACTTT
ACCCTCTGCTGCGCCTATACGTTGCTGGCGCACGCCTCGGAGCTGGACTGGGCGGCTGAGTATGGCGTGAGGGAG
CATTTGCAACCAAACATGCCCCAACAAGACCTCTATCCCCTCTGGGTCAACGGACGAGACACGCCAGGCAACGGC
CCAGTCATCCCCATCGAGGACCCGTCCACCAGCCACGTCTTCGCCCACTGCCAATCCGCCTCACCCTCCGACGTC
GAAGCCGCCATCCAGCTCGCCCACGACACCTTCCAGTCCGGAACATGGTCACGAGCCCCCCGCCACACACGAGCC
CTCGTCCTCGACCGCGCAGCCGACCTCCTCACCGCCGAGCTCCCGGCCCTCATCCAGCTCGAGGTCCGGCAGACG
GGCCGGGCTCTCCGGGAGATGACGGCCCAGCTTCCGACGCTGCGTGCCTGGTTCCGATACTATGCCGCCGTTCTC
CGCACCGAGCAGCGATCTCTACTGCCGACGACGGGCTCGCTGCACAACTGGATAGAGCGCATCCCTCTCGGTGTC
GTCGTCCAGCTGACGCCCTATAACCACCCTCTCCTCATCGCCGTCAAGAAGCTGGCCCCTGCACTGGCAGCCGGC
AACAGCGTGCTCCTCAAACCCAGCGAGCTGGCACCTCTAACCAGCCTCCGTCTCGGCCCCGTGCTCAAAGCCGCG
GGTCTTCCGGACGGCGTACTGGCCGTTCTCCCGGGCCTCGGCTCCGTGACCGGCGCGGCGCTGGTGGGGAACCGG
CTCGTCCGAAAGGTGGATCTCACGGGCGGAACGGCGGCGGGGCGGGAGATGGGCGCTGTGGTCGGTCGGAATCTG
GGCCGATTTACGGCTGAGTTGGGGGGCAAGGCTCCGCTGGTTGTCTTTGACTCGGCTTGCGTGGAGGCTGCTGTC
AATGGCATCGCTTTTGGCGCGTTTGTGGCTTCGGGTCAGACTTGTGTTGCGGCTACGCGTGTTATTGTTCATGTC
AGTTTGCTTGCAGACGTGGAGGAGAAGCTGAGGATCAAAAGCGAGTCCATCGTCAGACGAATGGGCTCACCTTCG
AACCCGGATTCATCCATGGGAAGTCTCATCTCCGCCCGTCAGCTCGATATAGTCGATGCTCTCGTACAAGAGGCA
GTCTCCGGTCCGGATCCCGGGGCCCGGCTGGTCTGCGGCGGACGGCGGATGACGAACATTTCTCAGCTGGACGGC
ACAGACTTCTCTAAGGGGCACTTCTACCCGCCTACAGTTCTATCGTCGACATCCGGCCGCAGCATCACGGCCACC
CGTCTCTGGCGCGAAGAGGCCTTTGGTCCGGCCGTCGTTCTCGTGGGCTTTGACACCGAGGCTGAGGCCGTTCAG
CTGGCCAACGATAGCGAGCTGGGCCTTGGAGCTGCCATCTGGACGCGAGACCTTTCCCAGGCGTTTCGTGTGACG
GGGCTCATCAACTGCGGCATCGTTTGGGTCAACACCCATCACCGGAATGATCCCAGCAGTCCCTGGGGGGGAACG
ACCAATGCCAGCGGTGTTGGGAGCGAGAACGGGCTGGAAGCCTATTACTCTTACACGTCGACCAAGAGCATCATC
GTCAACTACGCAGACGCTCAGCAGTCTCTCCTCGACGATGACTGGTTCGGGGAGGGGGCCGAGGGTGTTCGGTAC
GGCTAA
Gene >Ophun1|3382
ATGGATCCCAACAGCAGTGATGAAGCTCACCTCGCCGCTCTCGGCCTCCGCTCCGAACTCCGCCGGTCCTTCTCA
ACGCTGTCCATGCTCGGCCTCGCCTTTGCCGTCCTCAATGTTCAGCATCACCCCCTGAACCAGCAGCGGGAAAGC
TGACAGACACTGTAGACCTGGACGGCTGTATCGGCGAGCCTGCCCGTAAGCCTCACTTCCGGAGGCAGCACCAGC
ATCATCTGGGGTGCGTTACACATCGACTCTCTCATTCGTCTTGATGTCTCTGATGGAACCAAGGTCTCTTTGCGG
CTGGGTTGTGCAACCTGTGCATCGCTGCTTCGCTCGCTGAGCTCCTCTCGGCATATCCTACGTGAGATTCCCCTT
GTCGTTTACTTGCCTCGTTCGGTGCCTCGTTTACTAAACGGTTTCAGTGCTGGGGGTCAGTATCATTGGGTGGCC
GGTGAGCAGTCCTCTTGTCTCTGAAGCGCATCTTCGTCACTTACACTGGGATCCGATAGCCAGTACGACGATATC
CTGATCCCCGGCTTCATCCACAAGTTCTAACAGTTGACTTCAGTCTCGTGGCCATCATGGATGCCTCTCCTATCG
TGGATCAACGGCTGGATCGCCATCGCCGGCTGGGTGCGACCTCTATCCAGATACCCTCCCCGTCACTAACACAGC
CTCCTCGCAGGTCGCCCTGGTAGCCACCAACGCACTGCTATCAAGCCAGCTGATCCTCGGCATCGTCTCACTGCT
ACATCCCAGCTACGAGACCCAACGATGGCACCAGTTCCTCATCTACACCGCCCTGACCATCCTCTCCTTTCTCGT
CAACGCCTTTCTCAACTCGCTGCTGCCGCTCATCTACCGCGGGGCTTTTGCCTGGTCCATCGGCGGCTTCGTCGT
TGCCTGTGTGGTTATGCTGGCCTGTGCATCTCCGGACTTTCACTCGGCTGAGTTTGTCTTTGGGCAGTTTATCAA
TCGGACGGGATGTAGGTTTTCTCTTTGTCGATGCTGCTTGACTGGTAGAGCTAAGCTTGTCGATTCAGGGCCTGA
TGCCGTCGCCTGGCTTTTGGGGGTGAGCAACTCGACTTCCAGTACAAGTCTGGCTTCTAATGTGCTGTTCAATAG
CTTCTTCAAGGGGGACTCGGTGTCACGGCTTTCGTACGTCACAACCCCCTTCTTCGAGACGATGAGACTTATATA
TATCCCAAGGATGCCGTAGCACACATGATTGAAGGTAAATGCCTCTCCACCCTCCTCGATAAACAAATCCCGACT
CACCAGCTCAGAGATCCCCCAGGCCTCCCTCCAGGGCCCCAAGATCATGATCCTCTGCGTCATCATCGGCACCGT
AACGGGCGCCATCTTCCTCGCCGTCCTTCTCTCCGTTTCCGGAGACATTGAATCCGTCATTAGCTCGAGCGCCGG
CCCGCTGCTGCAGATCTTGGTCAACGCCACTGGCAACGCGGCCGGGGCCATCTGTCTGCTCATGTACGTCCCGTG
ACGGTGAAGCTCGTGATAATTCTAGCTGCTGATGAGTTTAGGCTGCCTCTGGTCTGCCTCGTCTTCGCTCTGTTG
AGTGTCATGACGACGAGCAGCCGGATCATCTATGCCTTTGCGCGGTACGACCTGTATCCGAAATCAATACTCGAT
CATGGCTCTGATAGAAGCAGTGATGGCGGTCTTCCAGCCTCGACCGTCTTCGTCAGAGTCCATCCCAAGCTCGGT
CAGCCACTCAACGCCCTGGCCCTCAGCTCAGCCGTCGTCGTTCTGTTCGGCCTGATCTTTCTGGCTTCATCGAGG
TACGTGTGTGTCTAGGAGCGGACAAGAGGCTTCGATACTTACAAGACAGTGCCTTCAACGCCATCATGTCGTCCT
CGGTCGTCGCCCTCGACCTCTCGTACGCCATGCCCATCGCCATACGCTGTCTCCGAGGCCGCAGTCCGCTCCCTC
AGGGGCAATGGAAGCTGTCCCCCCTTCTGGGATGGACCGTCGACACGGTCTCGCTGGCCTATATAACGCTGACGA
CCTTTTTGTTCCTACTGCCGCCCAGCCGGCCGGTAACGGGGACCAACATGAGTGCGTGATGATAGATGTAGTCAT
TCATTATCAAGTACGGATAAGTGCTGACGACTCTTCAGATTACTGCATCGTCGCCTTTGCCGTCGTCATCATCGT
CTCTGTTCTTCAATGGCTCGTCGACGGCCGGAAGAAGTTTGTTGGGCCGCGGCTCAGCTTCGACTTGGCTGAGGA
GAGACACGAGACGTCTGAGAAGGAGAAGTAGCTGCAACGTCAGCATCTGTGCAGCGTGCTAGCAGATGATTTGCT
CCCTGGAGGTCATCAGGGTACGAGGTAATGGATTTATTGGTAGCATCAATGGTTGGGCTTCAAGATGGCTAGGCT
GTGCTACATGTATTCGTACGCTGTTGATCGTACATGTTCCCTGTCATCTACATGCACATTTATGAATATATGACA
TCGTCAAACACATACAGGCCCTCCCGTGGCGCCTACCTGCAGCTCACCGAGCATTGGAACTGATACGAACTCGCC
AGTGCAACCCCAGTCTCGACCCCGTGTCATCACAAGACAGGCGCCCTCCCTTCCTCACTCCCTCCCAACCTGCAA
GCCTCCTCGAAGCAGTATCAGACGGATGACAGCCAGACTCGGAGAGCCTCTCCCGCCAGGAGACGAGCATGTGAG
ATCCCCCCTTGGCTCACCACCTCCTCCAACCATCGTCACTGACATCCCAGGCCGTCAGCGTCTCGCTCCCAACAT
GGCGAGATACCCTGGGCTGGGCCCATCGAGACCCTCAGCTTCTCTCCCAGCTCGACGCCGGCTATCCTCGCTTCT
TCGTCCCTCATCTCGTCCGCGCTCTGGCCGCTAGGTTGCTGGAATGGACAAGACAGAATCATCAGCCCGTGCCAG
CTTCCGACATCTCGGCCATGCTCTTCCCCAGCAGTATCATGGCCACATCCTGCGAGCGCTACTTAAGAGACCGAT
CCGACGACTCTTCAGGGGCTGTCATAACCTCCCTCGCCATCCGGATCGACGGCTCCTTCAAAACCCGAGACGAAA
CATGCGGAGAGGACGTCTTGATGGTGCTTCATCCGGAGACGCTCGCAGCCGAGGCAAAGGCCTTCTGGCAACACA
CGGGCTTCGGCATCTCGAGCCGCTTCGCCGCCCACTGGTTGAAGACGGCCCCCTTTCTCGGAGGGAAGACCGAGC
CGCTACCGCTAAAGGAAGCTCACGATGCCGGCCTCGCTCTCAGCAGCCGTATCGCCGGCCTCTACTCTACCGGTC
CGGACCATGTCTTTCTCTACCATACGGGCATGTCGGCCATGGCCCACGCCGCCTCGGCCATCCGTCGGCTCAGCG
GCCGGGCGGAAAAGGGCTTCCGGGTTGTTGTCTTCGGGTTCGTCTTGTTCGTCTCGTCGTCTGTCTCGTCTGACC
CGTTGAGGCTGGCAGGTTTCCCTACGTCGATACCTTCAAGGTGCTCAGCAAGGTATACGGCTTCGACTGCGTGCT
GTACGGCCACGCCTCGGCCACAGAACTCGACGAGCTGGAAGCTGGATTGGAGTCTGGCTCGCGTCTAGACGTCGT
CGTCACTGAGTTTCCGGGTAACCCCCTACTTCGATCCGTCGATCTGGCGAGACTGAATGCGCTCTCGCGGAAGCA
CGGCTTCTACATCATCATCGACGACACCATCGGAACTGCCGTCAACCTCGATCTCAGCTCATCCTACGACGTCGT
CTGTACGAGCCTGACCAAGATGTTTAGCGGCGCCTGCAACGTCATGGGCGGGAGCATCGTCCTCGGTCCCCGTTG
CCAGCATCGTGACTCCCTACGAGCAGCCCTCTCGGACCTTTACGAGGACACGTACTTTCCCCTCGACGTCATCGT
CATGAACACCAACAGCGTCGGCTTCGAGAGCCGCGTCCAGCTGGCGAGCCGCAACGCGGAAAGAGTCGTCGACCG
CCTTAGACATCACAGGGTCGTCGAGACGGTCTACTATCCGCGCGGCAGCCCGACACAGCACCTGTACGACAACTT
CAGACGGGCCGGAGCTGGATACGGCTACCTGCTTTCCATCGAGTTCGTCGAGCCGGCCGCGGCCACGGCCTTTTT
CGATGCCCTCGACGTGGCCAAGGGGCCGAGCCTGGGCACCAACTTTACCCTCTGCTGCGCCTATACGTTGCTGGC
GCACGCCTCGGAGCTGGACTGGGCGGCTGAGTATGGCGTGAGGGAGCATTTGGTGCGTATCAGCGTGGGGATCGA
GGAGGAGGAGTCGCTGTTGGCGCTGGTTGATGTTGCTTTGGCGGCGGCTGAGTTGAGATGCCCGGTAGAGGGAGT
TGAGTGAGAGGGAAGAGGCTGATGTTGGTGTTGGGGTGAGGCATTGTGTTGTTGTTCAGAAGGGGACATGTATGG
CGCAAGGACAGGGCATTTGTGGCTTATACATTGGTGTTTACCATTAATCTCTTGAAGCCTGTTACTGTCTGTGTC
TGTATGCTCATCGTGAACGGTGTGGCAACACATAAGAATCATGTACGAATATTCGACCATCACATCTCTCCCGTC
TGTTGCTTGACGTCATTACCTCCATCACGAACCACATAGTCTTCTTCCCAACAGAATAATACAACACATCTGCAA
TCATCTCGTACAAACACAATCTCTGGTCGTCAACATGGTTGCATCAACCGCCCCGTTCTAAACCCAACTCCATGC
GGGGTAACCTCACGATAACCTCACATCAACTCCCAGCAACCAAACATGCCCCAACAAGACCTCTATCCCCTCTGG
GTCAACGGACGAGACACGCCAGGCAACGGCCCAGTGTACGCTCATACCCCCCCAAACAGCCCTGCTTCCTCCCTG
CTAACCCTCTGACCCCAGCATCCCCATCGAGGACCCGTCCACCAGCCACGTCTTCGCCCAGTACGACTACATCCA
TCCCCCCAACAACCATCCATAAGCCCGTCCACTCACCAAAACCCAGCTGCCAATCCGCCTCACCCTCCGACGTCG
AAGCCGCCATCCAGCTCGCCCACGACACCTTCCAGTCCGGAACATGGTCACGAGCCCCCCGCCACACACGAGCCC
TCGTCCTCGACCGCGCAGCCGACCTCCTCACCGCCGAGCTCCCGGCCCTCATCCAGCTCGAGGTCCGGCAGACGG
GCCGGGCTCTCCGGGAGATGACGGCCCAGCTTCCGACGCTGCGTGCCTGGTTCCGATACTATGCCGCCGTTCTCC
GCACCGAGCAGCGATCTCTACTGCCGACGACGGGCTCGCTGCACAACTGGATAGAGCGCATCCCTCTCGGTGTCG
TCGTCCAGCTGACGCCCTATAACCACCCTCTCCTCATCGCCGTCAAGAAGCTGGCCCCTGCACTGGCAGCCGGCA
ACAGCGTGCTCCTCAAACCCAGCGAGCTGGCACCTCTAACCAGCCTCCGTCTCGGCCCCGTGCTCAAAGCCGCGG
GTCTTCCGGACGGCGTACTGGCCGTTCTCCCGGGCCTCGGCTCCGTGACCGGCGCGGCGCTGGTGGGGAACCGGC
TCGTCCGAAAGGTGGATCTCACGGGCGGAACGGCGGCGGGGCGGGAGATGGGCGCTGTGGTCGGTCGGAATCTGG
GCCGATTTACGGCTGAGTTGGGGGGCAAGGCTCCGCTGGTTGTCTTTGACTCGGCTTGCGTGGAGGCTGCTGTCA
ATGGCATCGCTTTTGGCGCGTTTGTGGCTTCGGGTCAGACTTGTGTTGCGGCTACGCGTGTTATTGTTCATGTCA
GTTTGCTTGCAGACGTGGAGGAGAAGCTGAGGATCAAAAGCGAGTCCATCGTCAGACGAATGGGCTCACCTTCGA
ACCCGGATTCATCCATGGGAAGTCTCATCTCCGCCCGTCAGCTCGATATAGTCGATGCTCTCGTACAAGAGGCAG
TCTCCGGTCCGGATCCCGGGGCCCGGCTGGTCTGCGGCGGACGGCGGATGACGAACATTTCTCAGCTGGACGGCA
CAGACTTCTCTAAGGGGCACTTCTACCCGCCTACAGTTCTATCGTCGACATCCGGCCGCAGCATCACGGCCACCC
GTCTCTGGCGCGAAGAGGCCTTTGGTCCGGCCGTCGTTCTCGTGGGCTTTGACACCGAGGCTGAGGCCGTTCAGC
TGGCCAACGATAGCGAGCTGGGCCTTGGAGCTGCCATCTGGACGCGAGACCTTTCCCAGGCGTTTCGTGTGACGG
GGCTCATCAACTGCGGCATCGTTTGGGTCAACACCCATCACCGGAATGATCCCAGCAGTCCCTGGGGGGGAACGA
CCAATGCCAGCGGTGTTGGGAGCGAGAACGGGCTGGAAGCCTATTACTCTTACACGTCGACCAAGAGCATCATCG
TCAACTACGCAGACGCTCAGCAGTCTCTCCTCGACGATGACTGGTTCGGGGAGGGGGCCGAGGGTGTTCGGTACG
GCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail