Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3381
Gene name
LocationContig_30:12537..14793
Strand-
Gene length (bp)2256
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 3.3E-66 35 469
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 6.3E-09 29 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 26 479 5.0E-92
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 41 472 2.0E-70
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 27 463 2.0E-37
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 27 466 3.0E-35
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 38 463 6.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 26 479 5.0E-92
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 41 472 2.0E-70
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 27 463 2.0E-37
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 27 466 3.0E-35
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 38 463 6.0E-31
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 7 489 2.0E-28
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 18 471 1.0E-25
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 18 477 2.0E-25
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 48 471 1.0E-24
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 52 466 1.0E-23
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 250 478 1.0E-21
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 52 471 1.0E-21
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 239 478 4.0E-21
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 273 478 4.0E-21
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 246 467 4.0E-21
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 26 471 1.0E-20
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 246 467 7.0E-20
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 246 467 8.0E-20
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 53 466 2.0E-19
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 246 476 8.0E-19
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 53 466 2.0E-18
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 246 466 1.0E-16
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 261 473 1.0E-16
sp|O96570|A37C_DROLE Protein anon-37Cs OS=Drosophila lebanonensis GN=anon-37Cs PE=3 SV=1 18 466 2.0E-16
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 262 473 5.0E-16
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 25 466 4.0E-15
sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 20 472 9.0E-15
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 5 487 2.0E-12
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 26 488 7.0E-12
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 246 471 7.0E-12
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 19 473 9.0E-12
sp|P81383|OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah PE=1 SV=3 26 449 1.0E-11
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 27 472 1.0E-11
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 245 470 4.0E-11
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 27 488 7.0E-11
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 245 514 9.0E-10
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 245 488 1.0E-09
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 243 485 1.0E-09
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 245 470 2.0E-09
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 245 514 3.0E-09
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 226 488 3.0E-09
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 245 487 3.0E-09
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 243 449 5.0E-09
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 245 498 5.0E-09
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 245 519 7.0E-09
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 27 485 7.0E-09
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 245 487 1.0E-08
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 246 488 1.0E-08
sp|Q6TGQ8|OXLA_BOTMO L-amino-acid oxidase (Fragment) OS=Bothrops moojeni PE=1 SV=1 26 449 1.0E-08
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 245 487 1.0E-08
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 245 487 2.0E-08
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 245 498 2.0E-08
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 243 449 3.0E-08
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 245 514 4.0E-08
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 245 470 4.0E-08
sp|Q6TGQ9|OXLA_BOTJR L-amino-acid oxidase (Fragment) OS=Bothrops jararacussu PE=1 SV=1 245 449 5.0E-08
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 246 470 5.0E-08
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 243 449 6.0E-08
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 246 470 7.0E-08
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 245 470 8.0E-08
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 245 519 9.0E-08
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 245 470 1.0E-07
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 245 514 1.0E-07
sp|X2JCV5|OXLA_CERCE L-amino acid oxidase OS=Cerastes cerastes PE=1 SV=1 245 488 1.0E-07
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 245 470 2.0E-07
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 245 470 2.0E-07
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 245 498 3.0E-07
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 245 470 4.0E-07
sp|X2L4E2|OXLA_BOTPC L-amino acid oxidase (Fragment) OS=Bothrops pictus PE=2 SV=1 245 470 6.0E-07
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 246 488 7.0E-07
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 234 449 1.0E-06
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 224 479 1.0E-06
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 245 473 3.0E-06
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 245 473 3.0E-06
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 245 473 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.977194

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6768
Ophiocordyceps australis map64 (Brazil) OphauB2|3856
Ophiocordyceps camponoti-floridani Ophcf2|00545
Ophiocordyceps camponoti-rufipedis Ophun1|3381 (this protein)
Ophiocordyceps kimflemingae Ophio5|7649
Ophiocordyceps subramaniannii Hirsu2|6559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3381
MLPVQLLASVLFASAAALPSGCARTKVAILGGGTAGITAAQALANASVHDFIILEYQDRIGGRAFHTQFGAGPDG
EPYTVELGANWVQGLGRPGGPENPIWTLAKKHHLKTTTNDYHSIATYTHKGASNFTALITVIEAAEKRMSVEAGR
MLAENEQDRSARAGLGLAGWAPAHDDMEAQAVEYWSWDWDSSLPPEQSSMIFGSAGNNLTFAQFSPNNNIVTDPR
GYDTLARAEAASFLSPNDPRLQLNKHITDIHYSNSSVTVSSSDGSCVQADYAICTFSLGVLQSDAIRFHPSLPPW
KQAAIRSFDMGTYTKLFLQFNHTFWPNDKQFMLYASPTQRGRYPIWQSLDGEGFINGSHIIFATATHDESYRIEQ
QSDAETQAELLDVLHEMFPDVQIPQPTAFLYPRWTKTPWARGSYSNWPVGTTLETHQNLRANAGRLWFAGEATSA
QYFGFLHGAWFEGREAGAHVAELASGRSCLRLEGEAEVCGERPQDVDTSRQTQSSIRSRSPSPGAASVTA*
Coding >Ophun1|3381
ATGCTGCCAGTCCAGCTCCTCGCCTCCGTCCTCTTCGCCAGCGCCGCTGCCCTTCCCTCCGGCTGCGCGAGGACC
AAAGTAGCCATCCTAGGGGGTGGCACAGCGGGCATCACAGCGGCCCAAGCCTTGGCCAACGCTTCGGTGCACGAC
TTCATCATCCTCGAGTATCAGGATCGTATTGGCGGGAGGGCATTCCATACGCAATTCGGCGCTGGACCTGATGGC
GAGCCTTATACCGTTGAGCTGGGCGCCAATTGGGTTCAAGGCCTCGGGAGACCGGGTGGACCTGAGAACCCCATC
TGGACACTGGCCAAGAAACACCACCTCAAAACAACAACAAACGACTACCATAGCATCGCAACCTACACCCACAAA
GGCGCCTCCAACTTCACCGCCCTCATCACCGTCATCGAAGCCGCAGAGAAGCGGATGAGCGTCGAGGCAGGTCGT
ATGCTGGCGGAGAACGAACAGGATCGCAGTGCGAGGGCCGGACTCGGGCTCGCCGGATGGGCGCCGGCTCATGAT
GATATGGAGGCGCAGGCAGTTGAGTATTGGAGCTGGGACTGGGACTCTTCCCTCCCCCCCGAACAGTCCTCCATG
ATCTTCGGCTCCGCTGGCAACAACCTCACCTTCGCCCAGTTCAGCCCAAACAACAACATCGTCACCGACCCCCGC
GGCTACGACACCCTCGCCCGCGCCGAAGCAGCCTCCTTCCTCTCCCCCAACGACCCTCGCCTCCAACTAAACAAG
CACATCACCGACATCCACTACTCCAACTCCTCCGTCACAGTCTCCTCCTCCGACGGCTCCTGCGTCCAGGCCGAT
TACGCCATCTGCACATTCTCCCTCGGCGTCCTGCAGTCCGACGCCATTCGCTTCCATCCGTCGCTGCCGCCTTGG
AAGCAGGCTGCCATCCGGAGCTTTGATATGGGCACTTACACCAAGCTCTTCCTGCAGTTCAATCACACCTTCTGG
CCCAATGATAAGCAGTTTATGCTGTATGCTTCGCCTACGCAGCGAGGCCGCTATCCGATCTGGCAGTCTCTTGAT
GGAGAGGGTTTCATAAACGGCTCGCACATCATCTTCGCCACAGCCACCCACGACGAATCCTACCGCATCGAACAG
CAGTCCGACGCCGAAACCCAAGCCGAACTCCTCGACGTCCTGCACGAGATGTTCCCAGACGTCCAAATCCCGCAA
CCAACAGCCTTCCTCTACCCCCGCTGGACAAAGACCCCCTGGGCGAGAGGCAGCTACTCCAACTGGCCCGTCGGC
ACCACGCTCGAAACCCACCAGAATCTAAGGGCCAACGCGGGCCGCCTCTGGTTCGCCGGCGAGGCCACCAGCGCC
CAGTACTTTGGCTTCCTGCACGGCGCCTGGTTCGAGGGTCGTGAAGCGGGTGCCCACGTTGCTGAGCTGGCGAGC
GGGCGGAGTTGCTTGCGTCTTGAGGGTGAGGCCGAGGTCTGTGGGGAGAGGCCTCAAGATGTCGACACGTCGCGC
CAGACGCAGTCCAGCATCCGGAGCCGAAGTCCGTCGCCCGGAGCGGCTTCGGTAACGGCGTAG
Transcript >Ophun1|3381
ATGCTGCCAGTCCAGCTCCTCGCCTCCGTCCTCTTCGCCAGCGCCGCTGCCCTTCCCTCCGGCTGCGCGAGGACC
AAAGTAGCCATCCTAGGGGGTGGCACAGCGGGCATCACAGCGGCCCAAGCCTTGGCCAACGCTTCGGTGCACGAC
TTCATCATCCTCGAGTATCAGGATCGTATTGGCGGGAGGGCATTCCATACGCAATTCGGCGCTGGACCTGATGGC
GAGCCTTATACCGTTGAGCTGGGCGCCAATTGGGTTCAAGGCCTCGGGAGACCGGGTGGACCTGAGAACCCCATC
TGGACACTGGCCAAGAAACACCACCTCAAAACAACAACAAACGACTACCATAGCATCGCAACCTACACCCACAAA
GGCGCCTCCAACTTCACCGCCCTCATCACCGTCATCGAAGCCGCAGAGAAGCGGATGAGCGTCGAGGCAGGTCGT
ATGCTGGCGGAGAACGAACAGGATCGCAGTGCGAGGGCCGGACTCGGGCTCGCCGGATGGGCGCCGGCTCATGAT
GATATGGAGGCGCAGGCAGTTGAGTATTGGAGCTGGGACTGGGACTCTTCCCTCCCCCCCGAACAGTCCTCCATG
ATCTTCGGCTCCGCTGGCAACAACCTCACCTTCGCCCAGTTCAGCCCAAACAACAACATCGTCACCGACCCCCGC
GGCTACGACACCCTCGCCCGCGCCGAAGCAGCCTCCTTCCTCTCCCCCAACGACCCTCGCCTCCAACTAAACAAG
CACATCACCGACATCCACTACTCCAACTCCTCCGTCACAGTCTCCTCCTCCGACGGCTCCTGCGTCCAGGCCGAT
TACGCCATCTGCACATTCTCCCTCGGCGTCCTGCAGTCCGACGCCATTCGCTTCCATCCGTCGCTGCCGCCTTGG
AAGCAGGCTGCCATCCGGAGCTTTGATATGGGCACTTACACCAAGCTCTTCCTGCAGTTCAATCACACCTTCTGG
CCCAATGATAAGCAGTTTATGCTGTATGCTTCGCCTACGCAGCGAGGCCGCTATCCGATCTGGCAGTCTCTTGAT
GGAGAGGGTTTCATAAACGGCTCGCACATCATCTTCGCCACAGCCACCCACGACGAATCCTACCGCATCGAACAG
CAGTCCGACGCCGAAACCCAAGCCGAACTCCTCGACGTCCTGCACGAGATGTTCCCAGACGTCCAAATCCCGCAA
CCAACAGCCTTCCTCTACCCCCGCTGGACAAAGACCCCCTGGGCGAGAGGCAGCTACTCCAACTGGCCCGTCGGC
ACCACGCTCGAAACCCACCAGAATCTAAGGGCCAACGCGGGCCGCCTCTGGTTCGCCGGCGAGGCCACCAGCGCC
CAGTACTTTGGCTTCCTGCACGGCGCCTGGTTCGAGGGTCGTGAAGCGGGTGCCCACGTTGCTGAGCTGGCGAGC
GGGCGGAGTTGCTTGCGTCTTGAGGGTGAGGCCGAGGTCTGTGGGGAGAGGCCTCAAGATGTCGACACGTCGCGC
CAGACGCAGTCCAGCATCCGGAGCCGAAGTCCGTCGCCCGGAGCGGCTTCGGTAACGGCGTAG
Gene >Ophun1|3381
ATGCTGCCAGTCCAGCTCCTCGCCTCCGTCCTCTTCGCCAGCGCCGCTGCCCTTCCCTCCGGCTGCGCGAGGACC
AAAGTAGCCATCCTGTCAGTCCTATCCGTCACCATGATGATATGTTATATCGATGTACCGCTGACGGGGTGATAA
GAGGGGGTGGCACAGCGGGCATCACAGCGGCCGTGAGTACAAGCCAGGCTTCTCTCGTCTTGGAATTCACTGGCT
GATGAAGGGATAGCAAGCCTTGGCCAACGCTTCGGTGCACGACTTCATCATCCTCGAGTATCAGGATCGTATTGG
CGGGAGGGCATTCCATACGCAATTCGGCGCTGGACCTGATGGCGAGCCTTATACCGTTGAGCTGGGCGCCAATTG
GGTGCGTCTTTTACTACCCTCGAGGAGGAAAGATGCTGAGAGTTGCTGGATAGGTTCAAGGCCTCGGGAGACCGG
GTGGACCTGGTGAGTTCCCATCCATCCATCCCCTTCACCTTCAACCAACATGGAAACTAACAGAAACAGAGAACC
CCATCTGGACACTGGTAAGAACCTCCCCTCTCCCCCCCCACAGCACTAACACCACGCAGGCCAAGAAACACCACC
TCAAAACAACAACAAACGACTACCATAGCATCGCAACCTACACCCACAAAGGCGCCTCCAACTTCACCGCCCTCA
TCACCGTCATCGAAGCCGCAGAGAAGCGGATGAGCGTCGAGGCAGGTCGTATGCTGGCGGAGAACGAACAGGATC
GCAGTGCGAGGGCCGGACTCGGGCTCGCCGGATGGGCGCCGGCTCATGATGATATGGAGGCGCAGGCAGTTGAGT
ATTGGAGCTGGGGTGAGTCGTCTCTCTCTTTCCAGGGGTTGACATCTATCTTCCGGGGTTGAGACCTGCTGGATG
TTCAGTAACTAACCCTCATCCCCAGACTGGGACTCTTCCCTCCCCCCCGAACAGTCCTCCATGATCTTCGGCTCC
GCTGGCAACAACCTCACCTTCGCCCAGTTCAGCCCAAACAACAACATCGTCACCGACCCCCGCGGCTACGACACC
CTCGCCCGCGCCGAAGCAGCCTCCTTCCTCTCCCCCAACGACCCTCGCCTCCAACTAAACAAGCACATCACCGAC
ATCCACTACTCCAACTCCTCCGTCACAGTCTCCTCCTCCGACGGCTCCTGCGTCCAGGCCGATTACGCCATCTGC
ACATTCTCCCTCGGCGTCCTGCAGTCCGACGCCATTCGCTTCCATCCGTCGCTGCCGCCTTGGAAGCAGGCTGCC
ATCCGGAGCTTTGATATGGGCACTTACACCAAGCTCTTCCTGCAGTTCAATCACACCTTCTGGCCCAATGATAAG
CAGTTTATGCTGTATGCTTCGCCTACGCAGCGAGGCCGCTATCCGATCTGGCAGTCTCTTGATGGAGAGGGTTTC
ATAAACGGCTCGCACATCATCTTCGCCACAGCCACCCACGACGAATCCTACCGCATCGAACAGCAGTCCGACGCC
GAAACCCAAGCCGAACTCCTCGACGTCCTGCACGAGATGTTCCCAGACGTCCAAATCCCGCAACCAACAGCCTTC
CTCTACCCCCGCTGGACAAAGACCCCCTGGGCGAGAGGCAGCTACTCCAACTGGCCCGTCGGCACCACGCTCGAA
ACCCACCAGAATCTAAGGGCCAACGCGGGCCGCCTCTGGTTCGCCGGCGAGGCCACCAGCGCCCAGTACTTTGGC
TTCCTGCACGGCGCCTGGTTCGAGGGTCGTGAAGCGGGTGCCCACGTTGCTGAGCTGGCGAGCGGGCGGAGTTGC
TTGCGTCTTGAGGGTGAGGCCGAGGTCTGTGGGGAGAGGGTTCGTTATGAGACGTTGAAGGGGACGTCGCCGCTG
GAGCATTATTCGCTTTTGAATGGGTGGGCTGCGAAGAGTTTTGCTGCGAGTCAGGTTGGGGGGGAGTAGGGGGCT
TGGATCATCGAGGTTGATGGGTTCGGAGGATTTAATCGTACATGATTTCAAGGAGAGTATATCATTCTGAGCTGT
CGATAGCAGTTTGATACCACGTGCAGAGATTGTGCAACGGACGGAGAGTTCGAATCGTACACCCGCGTGCAGACG
GTTAGAACCGCGCAGCACAAGGTCGTCGTATCTTCAGTTAGCAATCAGACTGACAGAATCTGGAAATAGCCTCAA
GATGTCGACACGTCGCGCCAGACGCAGTCCAGCATCCGGAGCCGAAGTCCGTCGCCCGGAGCGGCTTCGGTAACG
GCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail