Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3379
Gene name
LocationContig_30:9980..11145
Strand+
Gene length (bp)1165
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 1.5E-35 103 264
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 1.2E-06 49 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 12 285 9.0E-121
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 21 288 4.0E-109
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 22 288 9.0E-106
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 16 305 3.0E-105
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 22 288 5.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 12 285 9.0E-121
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 21 288 4.0E-109
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 22 288 9.0E-106
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 16 305 3.0E-105
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 22 288 5.0E-105
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 22 288 1.0E-104
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 15 288 1.0E-96
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 22 288 7.0E-95
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 27 289 4.0E-60
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 52 287 7.0E-60
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 52 287 8.0E-60
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 29 287 5.0E-57
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 29 290 5.0E-57
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 27 287 7.0E-57
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 26 290 2.0E-55
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 52 287 2.0E-54
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 52 287 2.0E-53
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 27 287 2.0E-53
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 15 287 5.0E-52
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 52 283 7.0E-52
sp|F4K6D3|SFH14_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH14 OS=Arabidopsis thaliana GN=SFH14 PE=2 SV=1 56 284 4.0E-46
sp|Q501H5|SFH13_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH13 OS=Arabidopsis thaliana GN=SFH13 PE=2 SV=1 39 287 6.0E-43
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 23 266 1.0E-25
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 56 266 4.0E-24
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 23 269 3.0E-23
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 23 268 4.0E-23
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 25 271 6.0E-23
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 25 267 1.0E-21
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 56 268 1.0E-21
sp|Q8R0F9|S14L4_MOUSE SEC14-like protein 4 OS=Mus musculus GN=Sec14l4 PE=1 SV=1 22 271 6.0E-21
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 25 267 2.0E-20
sp|Q99MS0|S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus GN=Sec14l2 PE=1 SV=1 52 271 6.0E-20
sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=1 SV=1 52 271 7.0E-20
sp|Q99J08|S14L2_MOUSE SEC14-like protein 2 OS=Mus musculus GN=Sec14l2 PE=1 SV=1 52 271 1.0E-19
sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1 52 271 3.0E-19
sp|P58875|S14L2_BOVIN SEC14-like protein 2 OS=Bos taurus GN=SEC14L2 PE=1 SV=2 52 271 1.0E-18
sp|Q9Z1J8|S14L3_RAT SEC14-like protein 3 OS=Rattus norvegicus GN=Sec14l3 PE=1 SV=1 52 271 4.0E-18
sp|Q9UDX4|S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens GN=SEC14L3 PE=1 SV=1 52 271 5.0E-18
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 41 267 3.0E-17
sp|B5MCN3|S14L6_HUMAN Putative SEC14-like protein 6 OS=Homo sapiens GN=SEC14L6 PE=5 SV=1 21 271 4.0E-16
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 56 264 2.0E-14
sp|Q56Z59|PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2 49 272 5.0E-13
sp|P49193|RALB_TODPA Retinal-binding protein OS=Todarodes pacificus PE=1 SV=2 113 265 2.0E-11
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 55 264 1.0E-10
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 56 264 2.0E-10
sp|Q19895|YUQP_CAEEL CRAL-TRIO domain-containing protein F28H7.8 OS=Caenorhabditis elegans GN=F28H7.8 PE=3 SV=2 33 266 3.0E-10
sp|Q9M0R2|PATL5_ARATH Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2 49 278 3.0E-10
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 56 265 8.0E-09
sp|Q9UUC2|YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.01 PE=2 SV=1 54 240 2.0E-08
sp|Q94C59|PATL4_ARATH Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 SV=2 54 264 4.0E-08
sp|Q9SCU1|PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1 46 279 4.0E-08
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 54 267 1.0E-07
sp|Q56WK6|PATL1_ARATH Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 SV=2 49 264 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3379
MDLNDKYDDYDFPHTAAEEKDGHAGYLTAEQIAQVHQLRMMLETDGYTDRLDTLTLLRFLRARKFDVNLSKQMFV
DCEKWRKDTNLDEEVPVWEYPERKDVAKYYKQYYHKTDKDGRPMYIETLGGIDLTAMYKITTPERMLTNLAVEYE
RLADPRLPACSRKAGKLLETCCTVMDLKGVTLTKVPQVYQYVKQASVISQNYYPERLGKLYLINAPWGFSTVWSV
VKGWLDPVTVAKINILGSGYKTDLLKQIPAECLPKAFGGTCECPGGCENSDAGPWHDPEWAKPAKWELKAKKKEE
IPDAAVQDHKAPVETADKDDGNQMAMA*
Coding >Ophun1|3379
ATGGATCTCAACGACAAGTACGACGACTACGACTTCCCGCACACCGCGGCGGAAGAGAAGGACGGTCATGCGGGA
TATTTGACGGCGGAGCAGATTGCGCAGGTTCATCAGCTACGTATGATGCTCGAGACGGATGGCTACACTGACCGG
CTCGATACCCTGACCTTGCTGCGATTCCTGCGAGCCCGCAAGTTTGATGTCAACCTCTCCAAGCAGATGTTCGTC
GACTGTGAGAAATGGCGCAAGGATACCAATCTTGACGAAGAGGTGCCCGTCTGGGAATATCCCGAGAGGAAGGAT
GTGGCCAAGTACTACAAGCAGTATTACCACAAGACTGACAAGGATGGACGTCCTATGTACATCGAGACCCTGGGC
GGCATCGATCTAACGGCCATGTACAAAATCACGACGCCGGAACGTATGCTCACCAACCTCGCCGTCGAGTATGAG
CGCCTCGCCGACCCCCGTCTCCCGGCCTGTTCGCGCAAGGCCGGCAAGCTTCTCGAGACGTGCTGCACCGTCATG
GACCTCAAGGGCGTCACTCTCACTAAGGTGCCGCAGGTATACCAGTATGTCAAGCAGGCCTCGGTCATTTCGCAG
AACTATTATCCCGAGCGGCTGGGCAAGCTATACCTCATCAATGCCCCTTGGGGCTTTTCCACCGTCTGGAGCGTC
GTCAAGGGCTGGCTGGACCCCGTCACCGTCGCCAAGATCAACATCCTCGGCTCCGGCTACAAGACGGACCTTCTC
AAGCAGATCCCGGCCGAATGCCTGCCCAAGGCCTTTGGCGGCACGTGTGAGTGTCCCGGAGGCTGCGAGAACAGC
GACGCCGGCCCGTGGCACGACCCGGAGTGGGCCAAGCCGGCCAAGTGGGAGCTCAAGGCCAAGAAGAAGGAGGAG
ATCCCGGATGCCGCGGTGCAAGATCATAAAGCCCCGGTCGAGACGGCGGACAAAGATGATGGAAATCAGATGGCC
ATGGCTTGA
Transcript >Ophun1|3379
ATGGATCTCAACGACAAGTACGACGACTACGACTTCCCGCACACCGCGGCGGAAGAGAAGGACGGTCATGCGGGA
TATTTGACGGCGGAGCAGATTGCGCAGGTTCATCAGCTACGTATGATGCTCGAGACGGATGGCTACACTGACCGG
CTCGATACCCTGACCTTGCTGCGATTCCTGCGAGCCCGCAAGTTTGATGTCAACCTCTCCAAGCAGATGTTCGTC
GACTGTGAGAAATGGCGCAAGGATACCAATCTTGACGAAGAGGTGCCCGTCTGGGAATATCCCGAGAGGAAGGAT
GTGGCCAAGTACTACAAGCAGTATTACCACAAGACTGACAAGGATGGACGTCCTATGTACATCGAGACCCTGGGC
GGCATCGATCTAACGGCCATGTACAAAATCACGACGCCGGAACGTATGCTCACCAACCTCGCCGTCGAGTATGAG
CGCCTCGCCGACCCCCGTCTCCCGGCCTGTTCGCGCAAGGCCGGCAAGCTTCTCGAGACGTGCTGCACCGTCATG
GACCTCAAGGGCGTCACTCTCACTAAGGTGCCGCAGGTATACCAGTATGTCAAGCAGGCCTCGGTCATTTCGCAG
AACTATTATCCCGAGCGGCTGGGCAAGCTATACCTCATCAATGCCCCTTGGGGCTTTTCCACCGTCTGGAGCGTC
GTCAAGGGCTGGCTGGACCCCGTCACCGTCGCCAAGATCAACATCCTCGGCTCCGGCTACAAGACGGACCTTCTC
AAGCAGATCCCGGCCGAATGCCTGCCCAAGGCCTTTGGCGGCACGTGTGAGTGTCCCGGAGGCTGCGAGAACAGC
GACGCCGGCCCGTGGCACGACCCGGAGTGGGCCAAGCCGGCCAAGTGGGAGCTCAAGGCCAAGAAGAAGGAGGAG
ATCCCGGATGCCGCGGTGCAAGATCATAAAGCCCCGGTCGAGACGGCGGACAAAGATGATGGAAATCAGATGGCC
ATGGCTTGA
Gene >Ophun1|3379
ATGGATCTCAACGACAAGTACGACGACTACGACTTCCCGCACACCGCGGCGGAAGAGAAGGACGGTCATGCGGGA
TATTTGACGGCGGAGCAGATTGCGCAGGTTCATCAGCTACGTATGATGCTCGAGACGGATGGCTACACTGACCGG
CTCGATACCCTGACCTTGGTATGACCTCTCCTACCCCCTCAAGCTTGGCGACGGTAATACGCAGGGAATACTGAC
TCGAAGACGTTTCACAGCTGCGATTCCTGCGAGCCCGCAAGTTTGATGTCAACCTCTCCAAGCAGATGTGAGTGT
GTCGGTGTTCTCACGAGCTCGCCCTGTGCTGACCGTTTCAGGTTCGTCGACTGTGAGAAATGGCGCAAGGATACC
AATCTTGACGAAGAGGTGCCCGTCTGGGAATATCCCGAGAGGAAGGATGTGGCCAAGTACTACAAGCAGTATTAC
CACAAGACTGACAAGGTAAGTCATTCATGGTCGTTCTCTATTTCGTACCTCTTGTCTGACGGGCTTCCTCCAGGA
TGGACGTCCTATGTACATCGAGACCCTGGGCGGCATCGATCTAACGGCCATGTACAAAATCACGACGCCGGAACG
TATGCTCACCAACCTCGCCGTCGAGTATGAGCGCCTCGCCGACCCCCGTCTCCCGGCCTGTTCGCGCAAGGCCGG
CAAGCTTCTCGAGACGTGCTGCACCGTCATGGACCTCAAGGGCGTCACTCTCACTAAGGTGCCGCAGGTATACCA
GTATGTCAAGCAGGCCTCGGTCATTTCGCAGAACTATTATCCCGAGCGGCTGGGCAAGCTATACCTCATCAATGC
CCCTTGGGGCTTTTCCACCGTCTGGAGCGTCGTCAAGGGCTGGCTGGACCCCGTCACCGTCGCCAAGATCAACAT
CCTCGGCTCCGGCTACAAGACGGACCTTCTCAAGCAGATCCCGGCCGAATGCCTGCCCAAGGCCTTTGGCGGCAC
GTGTGAGTGTCCCGGAGGCTGCGAGAACAGCGACGCCGGCCCGTGGCACGACCCGGAGTGGGCCAAGCCGGCCAA
GTGGGAGCTCAAGGCCAAGAAGAAGGAGGAGATCCCGGATGCCGCGGTGCAAGATCATAAAGCCCCGGTCGAGAC
GGCGGACAAAGATGATGGAAATCAGATGGCCATGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail