Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3378
Gene name
LocationContig_30:8194..9493
Strand-
Gene length (bp)1299
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 1.1E-46 191 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 124 417 6.0E-35
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 124 417 3.0E-34
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 124 417 4.0E-34
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 146 416 2.0E-33
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 178 418 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 124 417 6.0E-35
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 124 417 3.0E-34
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 124 417 4.0E-34
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 146 416 2.0E-33
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 178 418 2.0E-20
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 190 409 2.0E-13
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 169 423 4.0E-12
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 170 391 4.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6518
Ophiocordyceps australis map64 (Brazil) OphauB2|7616
Ophiocordyceps camponoti-floridani Ophcf2|00548
Ophiocordyceps camponoti-rufipedis Ophun1|3378 (this protein)
Ophiocordyceps kimflemingae Ophio5|4815
Ophiocordyceps subramaniannii Hirsu2|2065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3378
MSVAPQRTALINVSRTITSASAARPPYPNGRHVQPRAWLATTRRRLKFTSNGRGSGASRHHPSPPSPSPSHSQKQ
HHQDEPSNDEAGGAKRKAQRVKPRKNSLLRLAIDAHEAKKHGSGDKVATEQPSATPHEDVSEEPSMTISATCVAE
AFDMPLVVEILTSHGFALDPDRTGFVSGEVVHARSANGSDIFVFPSGTVVTWSLPVDAVTGQLMRAAEHPHKPDL
CEAEDLEFTVDPSKADSTMKGDLVILGTQREHTEGTPLDTTLAKVAFSSGLARSTKLAVLESTLDSYLESTRNIP
SLFSRGSAVSLGRRFILQKTGELLSLRARLNHYWELTDVLPDILWENEGLDNYYETVGRALDVRTRIKVLNQKMD
YAQEIATVLREVASERHGTRLELIIILLIAVEVVFEVRRIYLESVEGHEPSPEADTR*
Coding >Ophun1|3378
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGCACCATTACTTCTGCCTCGGCAGCACGTCCT
CCTTATCCTAATGGAAGACACGTCCAGCCGCGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTACTAGC
AATGGCCGTGGCAGCGGCGCATCCCGTCATCATCCGTCTCCTCCTTCACCTTCGCCTTCACATTCACAGAAGCAA
CACCACCAGGATGAACCCTCCAACGACGAGGCCGGCGGTGCAAAACGCAAAGCACAAAGAGTGAAACCACGAAAG
AACTCGTTGCTGAGGCTCGCCATCGACGCCCACGAGGCCAAGAAACACGGCTCCGGCGATAAGGTGGCTACCGAG
CAGCCATCCGCCACTCCGCACGAGGACGTCTCAGAGGAACCGTCCATGACCATCAGCGCTACATGCGTAGCCGAG
GCCTTCGACATGCCCCTCGTCGTCGAAATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGCACAGGCTTC
GTTTCGGGAGAGGTGGTCCACGCCCGCTCCGCCAATGGCAGCGACATCTTTGTCTTCCCCTCCGGCACAGTCGTC
ACCTGGTCGTTACCCGTCGATGCCGTGACCGGCCAACTCATGCGCGCAGCTGAGCACCCCCACAAGCCCGATCTC
TGCGAGGCCGAGGACCTCGAATTCACCGTCGACCCGTCCAAGGCCGACAGCACCATGAAAGGCGACCTCGTCATC
CTCGGCACCCAGCGCGAGCACACAGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTCTCATCCGGC
CTCGCCCGCAGCACCAAGCTAGCTGTGCTGGAGAGCACCCTGGATTCCTACCTCGAAAGCACCAGGAACATCCCC
TCCCTCTTCTCCCGCGGCTCCGCCGTCTCCCTCGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAGCTCCTCAGC
CTGCGCGCCCGCCTCAACCACTACTGGGAGCTAACCGACGTCCTCCCCGACATCCTCTGGGAGAACGAAGGCCTC
GACAACTACTACGAGACCGTCGGCCGCGCCCTCGACGTGAGGACGCGCATCAAGGTCCTGAACCAGAAGATGGAC
TACGCGCAGGAGATTGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGCCACGGCACCCGCCTCGAGCTCATCATC
ATCCTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTACCTCGAGTCCGTCGAGGGTCATGAGCCC
TCTCCTGAAGCCGATACCCGATGA
Transcript >Ophun1|3378
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGCACCATTACTTCTGCCTCGGCAGCACGTCCT
CCTTATCCTAATGGAAGACACGTCCAGCCGCGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTACTAGC
AATGGCCGTGGCAGCGGCGCATCCCGTCATCATCCGTCTCCTCCTTCACCTTCGCCTTCACATTCACAGAAGCAA
CACCACCAGGATGAACCCTCCAACGACGAGGCCGGCGGTGCAAAACGCAAAGCACAAAGAGTGAAACCACGAAAG
AACTCGTTGCTGAGGCTCGCCATCGACGCCCACGAGGCCAAGAAACACGGCTCCGGCGATAAGGTGGCTACCGAG
CAGCCATCCGCCACTCCGCACGAGGACGTCTCAGAGGAACCGTCCATGACCATCAGCGCTACATGCGTAGCCGAG
GCCTTCGACATGCCCCTCGTCGTCGAAATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGCACAGGCTTC
GTTTCGGGAGAGGTGGTCCACGCCCGCTCCGCCAATGGCAGCGACATCTTTGTCTTCCCCTCCGGCACAGTCGTC
ACCTGGTCGTTACCCGTCGATGCCGTGACCGGCCAACTCATGCGCGCAGCTGAGCACCCCCACAAGCCCGATCTC
TGCGAGGCCGAGGACCTCGAATTCACCGTCGACCCGTCCAAGGCCGACAGCACCATGAAAGGCGACCTCGTCATC
CTCGGCACCCAGCGCGAGCACACAGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTCTCATCCGGC
CTCGCCCGCAGCACCAAGCTAGCTGTGCTGGAGAGCACCCTGGATTCCTACCTCGAAAGCACCAGGAACATCCCC
TCCCTCTTCTCCCGCGGCTCCGCCGTCTCCCTCGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAGCTCCTCAGC
CTGCGCGCCCGCCTCAACCACTACTGGGAGCTAACCGACGTCCTCCCCGACATCCTCTGGGAGAACGAAGGCCTC
GACAACTACTACGAGACCGTCGGCCGCGCCCTCGACGTGAGGACGCGCATCAAGGTCCTGAACCAGAAGATGGAC
TACGCGCAGGAGATTGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGCCACGGCACCCGCCTCGAGCTCATCATC
ATCCTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTACCTCGAGTCCGTCGAGGGTCATGAGCCC
TCTCCTGAAGCCGATACCCGATGA
Gene >Ophun1|3378
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGCACCATTACTTCTGCCTCGGCAGCACGTCCT
CCTTATCCTAATGGAAGACACGTCCAGCCGCGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTACTAGC
AATGGCCGTGGCAGCGGCGCATCCCGTCATCATCCGTCTCCTCCTTCACCTTCGCCTTCACATTCACAGAAGCAA
CACCACCAGGATGAACCCTCCAACGACGAGGCCGGCGGTGCAAAACGCAAAGCACAAAGAGTGAAACCACGAAAG
AACTCGTTGCTGAGGCTCGCCATCGACGCCCACGAGGCCAAGAAACACGGCTCCGGCGATAAGGTGGCTACCGAG
CAGCCATCCGCCACTCCGCACGAGGACGTCTCAGAGGAACCGTCCATGACCATCAGCGCTACATGCGTAGCCGAG
GCCTTCGACATGCCCCTCGTCGTCGAAATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGCACAGGCTTC
GTTTCGGGAGAGGTGGTCCACGCCCGCTCCGCCAATGGCAGCGACATCTTTGTCTTCCCCTCCGGCACAGTCGTC
ACCTGGTCGTTACCCGTCGATGCCGTGACCGGCCAACTCATGCGCGCAGCTGAGCACCCCCACAAGCCCGATCTC
TGCGAGGCCGAGGACCTCGAATTCACCGTCGACCCGTCCAAGGCCGACAGCACCATGAAAGGCGACCTCGTCATC
CTCGGCACCCAGCGCGAGCACACAGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTCTCATCCGGC
CTCGCCCGCAGCACCAAGCTAGCTGTGCTGGAGAGCACCCTGGATTCCTACCTCGAAAGCACCAGGAACATCCCC
TCCCTCTTCTCCCGCGGCTCCGCCGTCTCCCTCGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAGCTCCTCAGC
CTGCGCGCCCGCCTCAACCACTACTGGGAGCTAACCGACGTCCTCCCCGACATCCTCTGGGAGAACGAAGGCCTC
GACAACTACTACGAGACCGTCGGCCGCGCCCTCGACGTGAGGACGCGCATCAAGGTCCTGAACCAGAAGATGGAC
TACGCGCAGGAGATTGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGCCACGGCACCCGCCTCGAGCTCATCATC
ATCCTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTACCTCGAGTCCGTCGAGGGTCATGAGCCC
TCTCCTGAAGCCGATACCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail