Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3371
Gene name
LocationContig_3:94528..95919
Strand+
Gene length (bp)1391
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 1.4E-73 28 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SRZ6|ICDHC_ARATH Cytosolic isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana GN=CICDH PE=2 SV=1 25 418 0.0E+00
sp|Q9Z2K9|IDHC_MICME Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus mexicanus GN=IDH1 PE=2 SV=1 32 415 0.0E+00
sp|P50217|IDHC_SOLTU Isocitrate dehydrogenase [NADP] OS=Solanum tuberosum GN=ICDH-1 PE=2 SV=1 25 418 0.0E+00
sp|P41562|IDHC_RAT Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus GN=Idh1 PE=1 SV=1 18 415 0.0E+00
sp|P50218|IDHC_TOBAC Isocitrate dehydrogenase [NADP] OS=Nicotiana tabacum PE=2 SV=1 25 418 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SRZ6|ICDHC_ARATH Cytosolic isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana GN=CICDH PE=2 SV=1 25 418 0.0E+00
sp|Q9Z2K9|IDHC_MICME Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus mexicanus GN=IDH1 PE=2 SV=1 32 415 0.0E+00
sp|P50217|IDHC_SOLTU Isocitrate dehydrogenase [NADP] OS=Solanum tuberosum GN=ICDH-1 PE=2 SV=1 25 418 0.0E+00
sp|P41562|IDHC_RAT Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus GN=Idh1 PE=1 SV=1 18 415 0.0E+00
sp|P50218|IDHC_TOBAC Isocitrate dehydrogenase [NADP] OS=Nicotiana tabacum PE=2 SV=1 25 418 0.0E+00
sp|P50215|IDH_SPHYA Isocitrate dehydrogenase [NADP] OS=Sphingobium yanoikuyae GN=icd PE=3 SV=1 25 418 0.0E+00
sp|Q5R9C5|IDHC_PONAB Isocitrate dehydrogenase [NADP] cytoplasmic OS=Pongo abelii GN=IDH1 PE=2 SV=2 32 415 0.0E+00
sp|Q8LPJ5|ICDHP_ARATH Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=At5g14590 PE=2 SV=1 25 422 0.0E+00
sp|Q9SLK0|ICDHX_ARATH Peroxisomal isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana GN=ICDH PE=1 SV=1 25 418 0.0E+00
sp|P21954|IDHP_YEAST Isocitrate dehydrogenase [NADP], mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDP1 PE=1 SV=1 8 424 0.0E+00
sp|O75874|IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens GN=IDH1 PE=1 SV=2 32 415 0.0E+00
sp|O88844|IDHC_MOUSE Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus GN=Idh1 PE=1 SV=2 32 415 0.0E+00
sp|Q75JR2|IDHP_DICDI Isocitrate dehydrogenase [NADP], mitochondrial OS=Dictyostelium discoideum GN=idhM PE=3 SV=1 25 418 0.0E+00
sp|P9WKL1|IDH_MYCTU Isocitrate dehydrogenase [NADP] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icd PE=1 SV=1 25 424 0.0E+00
sp|P9WKL0|IDH_MYCTO Isocitrate dehydrogenase [NADP] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icd PE=3 SV=1 25 424 0.0E+00
sp|P65098|IDH_MYCBO Isocitrate dehydrogenase [NADP] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icd PE=3 SV=1 25 424 0.0E+00
sp|Q75JR3|IDHC_DICDI Isocitrate dehydrogenase [NADP] cytoplasmic OS=Dictyostelium discoideum GN=idhC PE=1 SV=1 22 418 0.0E+00
sp|Q6XUZ5|IDHC_SHEEP Isocitrate dehydrogenase [NADP] cytoplasmic OS=Ovis aries GN=IDH1 PE=2 SV=1 32 415 0.0E+00
sp|P79089|IDHP_ASPNG Isocitrate dehydrogenase [NADP], mitochondrial OS=Aspergillus niger GN=icdA PE=2 SV=1 8 422 0.0E+00
sp|O13285|IDH1_CANTR Isocitrate dehydrogenase [NADP], mitochondrial OS=Candida tropicalis GN=IDP1 PE=3 SV=1 25 424 0.0E+00
sp|O13294|IDH2_CANTR Isocitrate dehydrogenase [NADP] peroxisomal OS=Candida tropicalis GN=IDP2 PE=1 SV=3 25 424 0.0E+00
sp|P41939|IDHC_YEAST Isocitrate dehydrogenase [NADP] cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDP2 PE=1 SV=2 24 424 0.0E+00
sp|Q04467|IDHP_BOVIN Isocitrate dehydrogenase [NADP], mitochondrial OS=Bos taurus GN=IDH2 PE=1 SV=2 25 425 0.0E+00
sp|Q4R502|IDHP_MACFA Isocitrate dehydrogenase [NADP], mitochondrial OS=Macaca fascicularis GN=IDH2 PE=2 SV=1 25 397 0.0E+00
sp|Q06197|IDHC_SOYBN Isocitrate dehydrogenase [NADP] OS=Glycine max GN=IDH1 PE=2 SV=2 25 418 0.0E+00
sp|P48735|IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens GN=IDH2 PE=1 SV=2 25 397 0.0E+00
sp|O14254|IDHP_SCHPO Probable isocitrate dehydrogenase [NADP], mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idp1 PE=3 SV=2 19 422 0.0E+00
sp|P33198|IDHP_PIG Isocitrate dehydrogenase [NADP], mitochondrial (Fragment) OS=Sus scrofa GN=IDH2 PE=1 SV=1 25 425 0.0E+00
sp|P54071|IDHP_MOUSE Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus GN=Idh2 PE=1 SV=3 25 424 0.0E+00
sp|P56574|IDHP_RAT Isocitrate dehydrogenase [NADP], mitochondrial OS=Rattus norvegicus GN=Idh2 PE=1 SV=2 25 424 0.0E+00
sp|P53982|IDHH_YEAST Isocitrate dehydrogenase [NADP] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDP3 PE=3 SV=1 24 422 0.0E+00
sp|Q40345|IDHP_MEDSA Isocitrate dehydrogenase [NADP], chloroplastic (Fragment) OS=Medicago sativa PE=2 SV=1 25 422 0.0E+00
sp|Q9XSG3|IDHC_BOVIN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Bos taurus GN=IDH1 PE=2 SV=1 32 415 0.0E+00
sp|Q9Z2K8|IDHC_MICOH Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus ochrogaster GN=IDH1 PE=3 SV=1 32 415 0.0E+00
sp|Q4FP17|LEU3_PELUB 3-isopropylmalate dehydrogenase OS=Pelagibacter ubique (strain HTCC1062) GN=leuB PE=3 SV=1 183 406 5.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3371
MNSPLFRLSRITFRLSRFTRKMHTKIKVRNPVVELDGDEMTRVIWKDIKQRFILPYLDIDLKYYDLGLEYRDETD
DQVTLDAAEAIKKYSVGVKCATITPDEARVKEFNLKKMWLSPNGTIRNALGGTVFREPIVIPRIPRLIPGWKKPI
IIGRHAFGDQYRAKDMVVPGPGKLSMVYTPDGGSPQEIQVFRFEGGGVGQTQYNTDESITGFAHASFKLAIDKCL
PLYMSTKNTILKKYDGRFKDIFQHLYDTQYKTEFEAKGIWYEHRLIDDMVAQMIKSSGGYIMALKNYDGDVQSDI
VAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYREHQKGKETSTNPIASIFAWTRGLAQRGKLDGTPELVAF
AERLEKACVDTVDDGIMTKDLALACGNKERSGYVTTSEYMTAVERRIGKGGMKL*
Coding >Ophun1|3371
ATGAACTCACCACTCTTCCGCCTCAGCCGCATCACCTTCCGCCTCTCCCGCTTCACCCGCAAAATGCACACCAAA
ATCAAGGTCCGCAATCCCGTCGTCGAGCTCGACGGCGACGAAATGACGCGCGTCATCTGGAAAGACATCAAGCAG
CGCTTCATCCTCCCCTACCTCGACATCGACCTCAAGTACTACGACCTCGGCCTCGAGTATCGCGACGAGACCGAC
GATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCCACCATAACGCCT
GACGAGGCTCGCGTCAAGGAATTCAACCTCAAGAAGATGTGGCTCTCTCCCAACGGCACCATCCGCAACGCCCTC
GGCGGCACCGTCTTTCGAGAACCCATCGTCATCCCTCGGATTCCCCGCCTGATTCCGGGCTGGAAGAAGCCCATC
ATCATCGGCCGCCACGCGTTTGGCGATCAATACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGGAAGCTGTCC
ATGGTTTATACTCCGGATGGCGGCTCTCCCCAAGAGATACAGGTGTTTCGCTTCGAGGGGGGGGGTGTGGGACAG
ACGCAGTACAATACGGACGAGTCCATCACCGGTTTTGCCCACGCCTCCTTCAAGCTCGCCATCGACAAGTGCCTC
CCGTTATACATGAGCACCAAAAACACCATCCTCAAGAAATACGACGGCCGCTTCAAGGACATTTTCCAACACCTC
TACGACACGCAGTACAAGACCGAGTTCGAAGCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTG
GCCCAGATGATCAAGAGCAGCGGCGGCTACATTATGGCTTTGAAGAACTACGACGGAGACGTCCAGTCCGACATT
GTCGCCCAAGGCTTCGGCTCCCTCGGCCTCATGACCTCGGTGCTCATCACCCCCGACGGCAAGACGTTTGAATCG
GAAGCCGCCCACGGCACGGTAACGCGCCACTACCGGGAGCACCAAAAAGGAAAGGAGACGTCTACCAACCCCATT
GCCTCTATATTTGCCTGGACGCGCGGGCTGGCTCAGCGGGGGAAGCTGGACGGAACGCCGGAGCTGGTTGCCTTT
GCGGAGCGGTTGGAAAAGGCGTGCGTCGATACCGTCGACGATGGCATCATGACAAAGGACCTCGCTCTGGCGTGT
GGGAACAAGGAGCGCTCTGGCTATGTGACGACGTCGGAGTACATGACGGCCGTTGAGCGGAGGATAGGGAAAGGG
GGGATGAAGCTGTGA
Transcript >Ophun1|3371
ATGAACTCACCACTCTTCCGCCTCAGCCGCATCACCTTCCGCCTCTCCCGCTTCACCCGCAAAATGCACACCAAA
ATCAAGGTCCGCAATCCCGTCGTCGAGCTCGACGGCGACGAAATGACGCGCGTCATCTGGAAAGACATCAAGCAG
CGCTTCATCCTCCCCTACCTCGACATCGACCTCAAGTACTACGACCTCGGCCTCGAGTATCGCGACGAGACCGAC
GATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCCACCATAACGCCT
GACGAGGCTCGCGTCAAGGAATTCAACCTCAAGAAGATGTGGCTCTCTCCCAACGGCACCATCCGCAACGCCCTC
GGCGGCACCGTCTTTCGAGAACCCATCGTCATCCCTCGGATTCCCCGCCTGATTCCGGGCTGGAAGAAGCCCATC
ATCATCGGCCGCCACGCGTTTGGCGATCAATACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGGAAGCTGTCC
ATGGTTTATACTCCGGATGGCGGCTCTCCCCAAGAGATACAGGTGTTTCGCTTCGAGGGGGGGGGTGTGGGACAG
ACGCAGTACAATACGGACGAGTCCATCACCGGTTTTGCCCACGCCTCCTTCAAGCTCGCCATCGACAAGTGCCTC
CCGTTATACATGAGCACCAAAAACACCATCCTCAAGAAATACGACGGCCGCTTCAAGGACATTTTCCAACACCTC
TACGACACGCAGTACAAGACCGAGTTCGAAGCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTG
GCCCAGATGATCAAGAGCAGCGGCGGCTACATTATGGCTTTGAAGAACTACGACGGAGACGTCCAGTCCGACATT
GTCGCCCAAGGCTTCGGCTCCCTCGGCCTCATGACCTCGGTGCTCATCACCCCCGACGGCAAGACGTTTGAATCG
GAAGCCGCCCACGGCACGGTAACGCGCCACTACCGGGAGCACCAAAAAGGAAAGGAGACGTCTACCAACCCCATT
GCCTCTATATTTGCCTGGACGCGCGGGCTGGCTCAGCGGGGGAAGCTGGACGGAACGCCGGAGCTGGTTGCCTTT
GCGGAGCGGTTGGAAAAGGCGTGCGTCGATACCGTCGACGATGGCATCATGACAAAGGACCTCGCTCTGGCGTGT
GGGAACAAGGAGCGCTCTGGCTATGTGACGACGTCGGAGTACATGACGGCCGTTGAGCGGAGGATAGGGAAAGGG
GGGATGAAGCTGTGA
Gene >Ophun1|3371
ATGAACTCACCACTCTTCCGCCTCAGCCGCATCACCTTCCGCCTCTCCCGCTTCACCCGCAAAATGCACACCAAA
ATCAAGGTCCGCAATCCCGTCGTCGAGCTCGACGGCGACGAAATGACGCGCGTCATCTGGAAAGACATCAAGCAG
CGCTTCATCCTCCCCTACCTCGACATCGACCTCAAGTACTACGACCTCGGCCTCGAGTATCGCGACGAGACCGAC
GATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCCACCATAACGCCT
GACGAGGCTCGCGTCAAGGAATTCAACCTCAAGAAGAGTAAGTCCACGGAAAGTCCACGAGAAGTCCGCGACTCG
ACTGATATCTGACCCCAGTGTGGCTCTCTCCCAACGGCACCATCCGCAACGCCCTCGGCGGCACCGTCTTTCGAG
AACCCATCGTCATCCCTCGGATTCCCCGCCTGATTCCGGGCTGGAAGAAGCCCATCATCATCGGCCGCCACGCGT
TTGGCGATCAATACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGGAAGCTGTCCATGGTTTATACTCCGGATG
GCGGCTCTCCCCAAGAGATACAGGTGTTTCGCTTCGAGGGGGGGGGTGTGGGACAGACGCAGTACAATACGGACG
AGTCCATCACCGGTTTTGCCCACGCCTCCTTCAAGCTCGCCATCGACAAGTGCCTCCCGTTATACATGAGCACCA
AAAACACCATCCTCAAGAAATACGACGGCCGCTTCAAGGACATTTTCCAACACCTCTACGACACGCAGTACAAGA
CCGAGTTCGAAGCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTGGCCCAGATGATCAAGAGCA
GCGGCGGCTACATTATGGCTTTGAAGAGTAAGCCGTCTCGTCAGAAGTCTATGATCTCGCTAATCCTTCTAGACT
ACGACGGAGACGTCCAGTCCGACATTGTCGCCCAAGGCTTCGGCTCCCTCGGCCTCATGACCTCGGTGCTCATCA
CCCCCGACGGCAAGACGTTTGAATCGGAAGCCGCCCACGGCACGGTAACGCGCCACTACCGGGAGCACCAAAAAG
GAAAGGAGACGTCTACCAACCCCATTGCCTCTATATTTGCCTGGACGCGCGGGCTGGCTCAGCGGGGGAAGCTGG
ACGGAACGCCGGAGCTGGTTGCCTTTGCGGAGCGGTTGGAAAAGGCGTGCGTCGATACCGTCGACGATGGCATCA
TGACAAAGGACCTCGCTCTGGCGTGTGGGAACAAGGAGCGCTCTGGCTATGTGACGACGTCGGAGTACATGACGG
CCGTTGAGCGGAGGATAGGGAAAGGGGGGATGAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail