Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3369
Gene name
LocationContig_3:87214..89768
Strand+
Gene length (bp)2554
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1568
Ophiocordyceps australis 1348a (Ghana) OphauG2|5034
Ophiocordyceps australis map64 (Brazil) OphauB2|4034
Ophiocordyceps camponoti-floridani Ophcf2|00717
Ophiocordyceps camponoti-floridani Ophcf2|06855
Ophiocordyceps camponoti-rufipedis Ophun1|2681
Ophiocordyceps camponoti-rufipedis Ophun1|3369 (this protein)
Ophiocordyceps kimflemingae Ophio5|1993
Ophiocordyceps kimflemingae Ophio5|2077
Ophiocordyceps kimflemingae Ophio5|6199
Ophiocordyceps kimflemingae Ophio5|7935
Ophiocordyceps subramaniannii Hirsu2|3551
Ophiocordyceps subramaniannii Hirsu2|3569
Ophiocordyceps subramaniannii Hirsu2|7031

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3369
MAQESSIEELKRLILEAKREADEARQEIQEIRRRDDAAEKAHQEKMERANAAVKAVRLTTLPEYMEACHFKISSR
LQVETRESMTTKGFTNPKGKWCPTRLVPWVDFLEIQTLTLGTLYNNFPIEDRFFLSRANVEGIGMNIRKPIGDEG
LTAFFLHLSLENPTLTIFDQLKKSETVCNAFDIGDGIGFDNHPHALSDVSAEVIQQLALMALTPAGPSTPDYRKD
LKNFKPDQICVYLSKGGGQRREMLFVSEYKPPHKLTKLHLRAGLRNMDLYREVVNRETMGTGDDRFEHEAEKLTA
SAITQTYHYMMEAGLEHGVLLTGEAMVFLKVDWTDPQTVFYHLAEPGPEVLAHPNEANVCSHLGQYLAFVLMALG
QPGQRRLHGQEERERIHKQLNTWAVDFHNTWLSMKDSKLKPEDSAYQPVTYKGVDRSPYVLRRKQQPADDEVKKI
KKDSPDSSDDEGPQPPDTPSPVGRVSAPRRSLRVQAQSRNQGQTRGQEQRRQQQPEQQQHGAQQGEQYCSSKCLA
GLVSGGLLDQACPNVHLHRKGSRKHISHKKWLRLLWKQLAKSLDDGITPLGQGGARGVLFRITLLGLGYTFVAKG
TIRVFVPDLEHEGSVYERLKPVQGVHVPVHLGAIDLDTMNKTYYFDHRVYIKYLMFLSFGGNTLNEAVNHSTRSA
LESKALCSLRAIHRFRVVHTDARLVNMLVHPVTGDVMVIDFERAKLMELEKRRPLGESTPNKRVCLAVEEKSSVS
VYKRDVHMAESDFADKIRVLEGKRW*
Coding >Ophun1|3369
ATGGCACAGGAATCGAGCATCGAGGAGTTGAAACGTCTCATCCTAGAGGCAAAGCGAGAAGCCGACGAAGCAAGG
CAGGAGATTCAGGAAATCCGACGGCGCGATGACGCGGCGGAAAAGGCACATCAGGAAAAGATGGAACGGGCTAAC
GCGGCAGTAAAGGCAGTGCGACTTACCACCCTCCCAGAATATATGGAAGCCTGTCACTTCAAAATCTCTTCGAGG
CTCCAAGTCGAAACAAGAGAGTCCATGACGACCAAAGGCTTCACAAATCCAAAGGGCAAATGGTGTCCCACCAGG
CTTGTTCCCTGGGTCGACTTTCTCGAGATTCAGACCCTTACACTGGGCACGCTGTACAACAATTTCCCCATCGAG
GACCGCTTTTTCCTCAGCAGGGCCAATGTGGAAGGAATCGGCATGAACATACGAAAGCCAATCGGCGATGAGGGA
TTGACGGCCTTTTTCCTCCACCTCAGCCTCGAGAACCCAACGTTGACGATATTCGACCAGCTAAAAAAGAGCGAG
ACGGTCTGCAACGCGTTTGATATAGGGGACGGCATCGGCTTTGACAATCATCCTCACGCCCTCAGCGATGTATCA
GCAGAGGTCATTCAACAGCTGGCGTTGATGGCCTTGACGCCCGCAGGGCCATCCACGCCAGACTACAGAAAGGAT
CTCAAAAACTTCAAGCCCGATCAGATCTGCGTCTATCTTTCGAAGGGAGGCGGACAGAGACGAGAAATGCTCTTC
GTCAGCGAGTACAAGCCTCCACACAAGTTGACCAAGTTGCATTTGCGAGCCGGCCTTCGAAATATGGACCTGTAC
AGGGAGGTGGTCAATCGGGAGACAATGGGCACCGGCGACGACCGCTTCGAACACGAGGCCGAGAAGCTTACGGCT
TCTGCCATCACGCAGACGTATCATTACATGATGGAGGCGGGTTTAGAACACGGGGTGCTTCTGACGGGCGAGGCC
ATGGTCTTTCTCAAAGTCGATTGGACTGATCCCCAGACTGTCTTTTACCACCTGGCGGAGCCTGGGCCGGAGGTA
TTGGCCCATCCCAACGAAGCCAATGTTTGCTCTCACCTGGGGCAGTACCTGGCCTTTGTCCTGATGGCTCTCGGT
CAGCCCGGACAGCGACGTCTGCACGGACAAGAGGAGCGTGAGAGGATTCACAAGCAGCTCAACACGTGGGCGGTC
GACTTCCACAACACATGGCTGTCGATGAAAGACAGCAAGTTGAAGCCGGAAGATTCAGCCTACCAGCCAGTCACC
TACAAGGGCGTTGATCGCTCGCCATACGTCCTCCGCCGGAAGCAACAGCCAGCCGATGACGAGGTGAAGAAGATC
AAGAAAGACAGTCCCGACTCTTCCGACGACGAGGGGCCCCAGCCTCCCGACACGCCTTCGCCTGTCGGTCGCGTC
TCAGCGCCCCGACGAAGCCTGCGCGTTCAGGCACAGTCCCGCAACCAGGGTCAAACCCGCGGACAGGAGCAGCGT
AGGCAGCAGCAGCCCGAACAGCAGCAGCACGGGGCACAGCAGGGAGAACAGTACTGCTCTTCGAAATGTCTTGCC
GGCCTCGTTTCTGGGGGTCTGCTGGATCAAGCCTGTCCCAACGTGCATCTCCACCGAAAGGGTTCTCGGAAACAC
ATTTCGCACAAGAAATGGCTCCGTCTTCTGTGGAAGCAGCTTGCCAAGTCGCTGGACGACGGCATCACTCCTCTA
GGACAAGGGGGGGCCAGGGGGGTGCTCTTCAGGATCACGCTGCTTGGGCTCGGCTACACGTTTGTGGCAAAAGGG
ACGATTCGCGTGTTTGTCCCGGATCTGGAGCACGAGGGAAGCGTCTATGAGCGACTAAAGCCGGTGCAGGGGGTT
CATGTGCCCGTCCACCTGGGAGCCATCGATCTGGACACGATGAACAAGACCTACTACTTTGATCATCGTGTTTAC
ATCAAGTATCTGATGTTTCTTTCCTTTGGAGGCAACACGTTGAACGAAGCCGTCAACCACTCAACTCGATCCGCT
CTGGAAAGCAAGGCCCTTTGCTCGCTACGGGCCATCCACCGATTTCGTGTCGTACACACGGACGCACGGCTTGTT
AATATGCTCGTGCATCCTGTGACGGGCGACGTCATGGTCATCGACTTTGAGAGGGCGAAGCTGATGGAGCTGGAG
AAGAGACGGCCGCTGGGGGAGTCGACGCCTAACAAGCGGGTATGCCTGGCGGTGGAAGAAAAGTCGTCTGTGTCT
GTTTATAAGAGGGATGTTCATATGGCAGAGTCTGATTTCGCAGACAAGATTAGGGTGTTGGAGGGGAAGCGGTGG
TAG
Transcript >Ophun1|3369
ATGGCACAGGAATCGAGCATCGAGGAGTTGAAACGTCTCATCCTAGAGGCAAAGCGAGAAGCCGACGAAGCAAGG
CAGGAGATTCAGGAAATCCGACGGCGCGATGACGCGGCGGAAAAGGCACATCAGGAAAAGATGGAACGGGCTAAC
GCGGCAGTAAAGGCAGTGCGACTTACCACCCTCCCAGAATATATGGAAGCCTGTCACTTCAAAATCTCTTCGAGG
CTCCAAGTCGAAACAAGAGAGTCCATGACGACCAAAGGCTTCACAAATCCAAAGGGCAAATGGTGTCCCACCAGG
CTTGTTCCCTGGGTCGACTTTCTCGAGATTCAGACCCTTACACTGGGCACGCTGTACAACAATTTCCCCATCGAG
GACCGCTTTTTCCTCAGCAGGGCCAATGTGGAAGGAATCGGCATGAACATACGAAAGCCAATCGGCGATGAGGGA
TTGACGGCCTTTTTCCTCCACCTCAGCCTCGAGAACCCAACGTTGACGATATTCGACCAGCTAAAAAAGAGCGAG
ACGGTCTGCAACGCGTTTGATATAGGGGACGGCATCGGCTTTGACAATCATCCTCACGCCCTCAGCGATGTATCA
GCAGAGGTCATTCAACAGCTGGCGTTGATGGCCTTGACGCCCGCAGGGCCATCCACGCCAGACTACAGAAAGGAT
CTCAAAAACTTCAAGCCCGATCAGATCTGCGTCTATCTTTCGAAGGGAGGCGGACAGAGACGAGAAATGCTCTTC
GTCAGCGAGTACAAGCCTCCACACAAGTTGACCAAGTTGCATTTGCGAGCCGGCCTTCGAAATATGGACCTGTAC
AGGGAGGTGGTCAATCGGGAGACAATGGGCACCGGCGACGACCGCTTCGAACACGAGGCCGAGAAGCTTACGGCT
TCTGCCATCACGCAGACGTATCATTACATGATGGAGGCGGGTTTAGAACACGGGGTGCTTCTGACGGGCGAGGCC
ATGGTCTTTCTCAAAGTCGATTGGACTGATCCCCAGACTGTCTTTTACCACCTGGCGGAGCCTGGGCCGGAGGTA
TTGGCCCATCCCAACGAAGCCAATGTTTGCTCTCACCTGGGGCAGTACCTGGCCTTTGTCCTGATGGCTCTCGGT
CAGCCCGGACAGCGACGTCTGCACGGACAAGAGGAGCGTGAGAGGATTCACAAGCAGCTCAACACGTGGGCGGTC
GACTTCCACAACACATGGCTGTCGATGAAAGACAGCAAGTTGAAGCCGGAAGATTCAGCCTACCAGCCAGTCACC
TACAAGGGCGTTGATCGCTCGCCATACGTCCTCCGCCGGAAGCAACAGCCAGCCGATGACGAGGTGAAGAAGATC
AAGAAAGACAGTCCCGACTCTTCCGACGACGAGGGGCCCCAGCCTCCCGACACGCCTTCGCCTGTCGGTCGCGTC
TCAGCGCCCCGACGAAGCCTGCGCGTTCAGGCACAGTCCCGCAACCAGGGTCAAACCCGCGGACAGGAGCAGCGT
AGGCAGCAGCAGCCCGAACAGCAGCAGCACGGGGCACAGCAGGGAGAACAGTACTGCTCTTCGAAATGTCTTGCC
GGCCTCGTTTCTGGGGGTCTGCTGGATCAAGCCTGTCCCAACGTGCATCTCCACCGAAAGGGTTCTCGGAAACAC
ATTTCGCACAAGAAATGGCTCCGTCTTCTGTGGAAGCAGCTTGCCAAGTCGCTGGACGACGGCATCACTCCTCTA
GGACAAGGGGGGGCCAGGGGGGTGCTCTTCAGGATCACGCTGCTTGGGCTCGGCTACACGTTTGTGGCAAAAGGG
ACGATTCGCGTGTTTGTCCCGGATCTGGAGCACGAGGGAAGCGTCTATGAGCGACTAAAGCCGGTGCAGGGGGTT
CATGTGCCCGTCCACCTGGGAGCCATCGATCTGGACACGATGAACAAGACCTACTACTTTGATCATCGTGTTTAC
ATCAAGTATCTGATGTTTCTTTCCTTTGGAGGCAACACGTTGAACGAAGCCGTCAACCACTCAACTCGATCCGCT
CTGGAAAGCAAGGCCCTTTGCTCGCTACGGGCCATCCACCGATTTCGTGTCGTACACACGGACGCACGGCTTGTT
AATATGCTCGTGCATCCTGTGACGGGCGACGTCATGGTCATCGACTTTGAGAGGGCGAAGCTGATGGAGCTGGAG
AAGAGACGGCCGCTGGGGGAGTCGACGCCTAACAAGCGGGTATGCCTGGCGGTGGAAGAAAAGTCGTCTGTGTCT
GTTTATAAGAGGGATGTTCATATGGCAGAGTCTGATTTCGCAGACAAGATTAGGGTGTTGGAGGGGAAGCGGTGG
TAG
Gene >Ophun1|3369
ATGGCACAGGAATCGAGCATCGAGGAGTTGAAACGTCTCATCCTAGAGGCAAAGCGAGAAGCCGACGAAGCAAGG
CAGGTACGTGACAAGGAAGCGGAGGTACGTGACAGGAAGTGGAGGGACGTGGATAGGTAGAGCGACGAGCCAACG
CAGCAGAGCAGGGACGTGAAAAGGCAGAGCGACGAGCCGCCGCAGCAATGGAGGTACGTGACAAGGAAGTGGAGG
GACGTGAAAAGGCAGAGCGACGAGCCAACGCAGCAGAGCAGGTACGTACGAGCGACGACGCGCTAATGAGGAATC
AAAGGAGATTCAGGAAATCCGACGGCGCGATGACGCGGCGGAAAAGGCACATCAGGAAAAGATGGAACGGGCTAA
CGCGGCAGTAAAGGCAGTGCGACTTACCACCCTCCCAGAATATATGGAAGCCTGTCACTTCAAAATCTCTTCGAG
GCTCCAAGTCGAAACAAGAGAGTCCATGACGACCAAAGGCTTCACAAATCCAAAGGGCAAATGGTGTCCCACCAG
GCTTGTTCCCTGGGTCGACTTTCTCGAGATTCAGACCCTTACACTGGGCACGCTGTACAACAATTTCCCCATCGA
GGACCGCTTTTTCCTCAGCAGGGCCAATGTGGAAGGAATCGGCATGAACATACGAAAGCCAATCGGCGATGAGGG
ATTGACGGCCTTTTTCCTCCACCTCAGCCTCGAGAACCCAACGTTGACGATATTCGACCAGCTAAAAAAGAGCGA
GACGGTCTGCAACGCGTTTGATATAGGGGACGGCATCGGCTTTGACAATCATCCTCACGCCCTCAGCGATGTATC
AGCAGAGGTCATTCAACAGCTGGCGTTGATGGCCTTGACGCCCGCAGGGCCATCCACGCCAGACTACAGAAAGGA
TCTCAAAAACTTCAAGCCCGATCAGATCTGCGTCTATCTTTCGAAGGGAGGCGGACAGAGACGAGAAATGCTCTT
CGTCAGCGAGTACAAGCCTCCACACAAGTTGACCAAGTTGCATTTGCGAGCCGGCCTTCGAAATATGGACCTGTA
CAGGGAGGTGGTCAATCGGGAGACAATGGGCACCGGCGACGACCGCTTCGAACACGAGGCCGAGAAGCTTACGGC
TTCTGCCATCACGCAGACGTATCATTACATGATGGAGGCGGGTTTAGAACACGGGGTGCTTCTGACGGGCGAGGC
CATGGTCTTTCTCAAAGTCGATTGGACTGATCCCCAGACTGTCTTTTACCACCTGGCGGAGCCTGGGCCGGAGGT
ATTGGCCCATCCCAACGAAGCCAATGTTTGCTCTCACCTGGGGCAGTACCTGGCCTTTGTCCTGATGGCTCTCGG
TCAGCCCGGACAGCGACGTCTGCACGGACAAGAGGAGCGTGAGAGGATTCACAAGCAGCTCAACACGTGGGCGGT
CGACTTCCACAACACATGGCTGTCGATGAAAGACAGCAAGTTGAAGCCGGAAGATTCAGCCTACCAGCCAGTCAC
CTACAAGGGCGTTGATCGCTCGCCATACGTCCTCCGCCGGAAGCAACAGCCAGCCGATGACGAGGTGAAGAAGAT
CAAGAAAGACAGTCCCGACTCTTCCGACGACGAGGGGCCCCAGCCTCCCGACACGCCTTCGCCTGTCGGTCGCGT
CTCAGCGCCCCGACGAAGCCTGCGCGTTCAGGCACAGTCCCGCAACCAGGGTCAAACCCGCGGACAGGAGCAGCG
TAGGCAGCAGCAGCCCGAACAGCAGCAGCACGGGGCACAGCAGGGAGAACAGTACTGCTCTTCGAAATGTCTTGC
CGGCCTCGTTTCTGGGGGTCTGCTGGATCAAGCCTGTCCCAACGTGCATCTCCACCGAAAGGGTTCTCGGAAACA
CATTTCGCACAAGAAATGGCTCCGTCTTCTGTGGAAGCAGCTTGCCAAGTCGCTGGACGACGGCATCACTCCTCT
AGGACAAGGGGGGGCCAGGGGGGTGCTCTTCAGGATCACGCTGCTTGGGCTCGGCTACACGTTTGTGGCAAAAGG
GACGATTCGCGTGTTTGTCCCGGATCTGGAGCACGAGGGAAGCGTCTATGAGCGACTAAAGCCGGTGCAGGGGGT
TCATGTGCCCGTCCACCTGGGAGCCATCGATCTGGACACGATGAACAAGACCTACTACTTTGATCATCGTGTTTA
CATCAAGTATCTGATGTTTCTTTCCTTTGGAGGCAACACGTTGAACGAAGCCGTCAACCACTCAACTCGATCCGC
TCTGGAAAGCAAGGCCCTTTGCTCGCTACGGGCCATCCACCGATTTCGTGTCGTACACACGGACGCACGGCTTGT
TAATATGCTCGTGCATCCTGTGACGGGCGACGTCATGGTCATCGACTTTGAGAGGGCGAAGCTGATGGAGCTGGA
GAAGAGACGGCCGCTGGGGGAGTCGACGCCTAACAAGCGGGTATGCCTGGCGGTGGAAGAAAAGTCGTCTGTGTC
TGTTTATAAGAGGGATGTTCATATGGCAGAGTCTGATTTCGCAGACAAGATTAGGGTGTTGGAGGGGAAGCGGTG
GTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail