Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3358
Gene name
LocationContig_3:55562..56402
Strand+
Gene length (bp)840
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999711

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6738
Ophiocordyceps australis 1348a (Ghana) OphauG2|784
Ophiocordyceps australis map64 (Brazil) OphauB2|1368
Ophiocordyceps australis map64 (Brazil) OphauB2|4853
Ophiocordyceps camponoti-floridani Ophcf2|06380
Ophiocordyceps camponoti-floridani Ophcf2|06854
Ophiocordyceps camponoti-rufipedis Ophun1|3358 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7054
Ophiocordyceps kimflemingae Ophio5|3331
Ophiocordyceps kimflemingae Ophio5|6004
Ophiocordyceps subramaniannii Hirsu2|56
Ophiocordyceps subramaniannii Hirsu2|9193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3358
MVRLLVISALALAVSVNAVIEEDPAGRKNVGIAGAQFIGGTCVDDANCATGKSPFQQFYHDPSDFCSRLLLRCCW
KSPERGLNAINTGGVKDVQGLGNQGNQGGQSNDPALARVGKGNRDQFITGPCATNADCTTDCCVSTLSSPEGKCS
ALAPAKDGDKLGCGTGPGERGLNGNNI*
Coding >Ophun1|3358
ATGGTTCGCTTACTGGTCATCTCTGCTCTCGCGTTGGCCGTCAGCGTCAACGCTGTTATAGAAGAAGACCCCGCA
GGGCGCAAGAATGTGGGAATTGCAGGGGCACAGTTCATTGGAGGAACCTGTGTGGACGACGCAAACTGCGCCACC
GGCAAGTCCCCTTTTCAACAGTTTTACCACGATCCTTCTGACTTCTGCTCAAGGCTGTTGCTGCGGTGTTGCTGG
AAAAGCCCTGAACGTGGACTCAATGCCATTAACACTGGAGGAGTTAAGGACGTCCAAGGACTCGGAAATCAGGGT
AATCAAGGCGGCCAGAGCAACGACCCAGCCCTTGCACGGGTTGGTAAAGGCAACCGTGATCAGTTCATTACCGGC
CCTTGCGCGACCAACGCCGACTGTACTACCGACTGCTGTGTCTCGACTTTGAGTTCACCAGAAGGGAAATGCAGC
GCTCTCGCTCCTGCAAAAGATGGCGATAAGCTCGGGTGTGGGACTGGTCCCGGAGAACGAGGCTTGAACGGCAAC
AACATCTGA
Transcript >Ophun1|3358
ATGGTTCGCTTACTGGTCATCTCTGCTCTCGCGTTGGCCGTCAGCGTCAACGCTGTTATAGAAGAAGACCCCGCA
GGGCGCAAGAATGTGGGAATTGCAGGGGCACAGTTCATTGGAGGAACCTGTGTGGACGACGCAAACTGCGCCACC
GGCAAGTCCCCTTTTCAACAGTTTTACCACGATCCTTCTGACTTCTGCTCAAGGCTGTTGCTGCGGTGTTGCTGG
AAAAGCCCTGAACGTGGACTCAATGCCATTAACACTGGAGGAGTTAAGGACGTCCAAGGACTCGGAAATCAGGGT
AATCAAGGCGGCCAGAGCAACGACCCAGCCCTTGCACGGGTTGGTAAAGGCAACCGTGATCAGTTCATTACCGGC
CCTTGCGCGACCAACGCCGACTGTACTACCGACTGCTGTGTCTCGACTTTGAGTTCACCAGAAGGGAAATGCAGC
GCTCTCGCTCCTGCAAAAGATGGCGATAAGCTCGGGTGTGGGACTGGTCCCGGAGAACGAGGCTTGAACGGCAAC
AACATCTGA
Gene >Ophun1|3358
ATGGTTCGCTTACTGGTCATCTCTGCTCTCGCGTGTAAGTCCCATATCGAATCCAACCGCATATCAACCTCGACA
ACGACATTGACTCGATATTCCTTTAAGTGGCCGTCAGCGTCAACGCTGTTATAGAAGAAGACCCCGCAGGGCGCA
AGAATGTGGGAATTGCAGGGGCACAGTTCATTGGAGGAACCTGTGTGGACGACGCAAACTGCGCCACCGGCAAGT
CCCCTTTTCAACAGTTTTACCACGATCCTTCTGACTTCTGCTCAAGGCTGTTGCTGCGGTGTTGCTGGAAAAGCC
CTGAACGTGTGCAGTTCGAAACTCGCTCAGACACAGAACGGGAAACTTGGCTGTAATACTGCTGACCAGGGACTC
AATGCCATTAACACTGGAGGAGTTAAGGACGTCCAAGGACTCGGAAATCAGGGTAATCAAGGCGGCCAGAGCAAC
GACCCAGCCCTTGCACGGGTTGGTAAAGGCAACCGTGATCAGTTCATTACCGGTAAGTCAATTTACCTACGGCCC
GTCTTCTAAACTTTATGACCTAACTGTGGTCACCTTCTAGGCCCTTGCGCGACCAACGCCGACTGTACTACCGTG
AGAAAGTCCAAATCTCTCTCATTTGACGTCTGTTGCTAACGTCAATGCAAGGACTGCTGTGTCTCGACTTTGAGT
TCACCAGAAGGGAAATGCAGCGCTCTCGCTCCTGCAAAAGATGGCGATAAGCTCGGGTGTGGGACTGGTAGGCAT
CCAGTCAATTACCTGGTCACCCTGTCTTGATCTAACGTTGTTATGTTCCTAGGTCCCGGAGAACGAGGCTTGAAC
GGCAACAACATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail