Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3353
Gene name
LocationContig_3:37798..41566
Strand-
Gene length (bp)3768
Transcript length (bp)3768
Coding sequence length (bp)3768
Protein length (aa) 1256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 4.7E-30 872 1043
PF00168 C2 C2 domain 5.2E-05 612 714

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 856 1153 1.0E-37
sp|Q5A506|BUD2_CANAL GTPase activating protein BUD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD2 PE=2 SV=1 535 1138 9.0E-37
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 852 1083 6.0E-32
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 852 1083 2.0E-31
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 875 1075 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 856 1153 1.0E-37
sp|Q5A506|BUD2_CANAL GTPase activating protein BUD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD2 PE=2 SV=1 535 1138 9.0E-37
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 852 1083 6.0E-32
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 852 1083 2.0E-31
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 875 1075 6.0E-30
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 875 1081 1.0E-29
sp|Q8C2K5|RASL3_MOUSE RAS protein activator like-3 OS=Mus musculus GN=Rasal3 PE=1 SV=1 852 1078 2.0E-29
sp|Q3UHC7|DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus GN=Dab2ip PE=1 SV=1 852 1061 3.0E-28
sp|Q9UJF2|NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens GN=RASAL2 PE=1 SV=2 876 1061 5.0E-28
sp|Q5VWQ8|DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens GN=DAB2IP PE=1 SV=2 852 1061 5.0E-28
sp|Q6P730|DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus GN=Dab2ip PE=1 SV=1 852 1061 6.0E-28
sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 863 1079 9.0E-27
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 864 1101 2.0E-26
sp|Q8T498|GAP2_DROME Probable Ras GTPase-activating protein OS=Drosophila melanogaster GN=CG42684 PE=1 SV=3 872 1103 3.0E-26
sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 863 1079 5.0E-26
sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 863 1079 8.0E-26
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 864 1101 1.0E-25
sp|Q9QUH6|SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus GN=Syngap1 PE=1 SV=2 875 1078 2.0E-24
sp|Q96PV0|SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens GN=SYNGAP1 PE=1 SV=4 875 1078 2.0E-24
sp|F6SEU4|SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus GN=Syngap1 PE=1 SV=2 875 1078 2.0E-24
sp|P48423|GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster GN=RasGAP1 PE=1 SV=2 877 1110 1.0E-20
sp|Q28013|RASA3_BOVIN Ras GTPase-activating protein 3 OS=Bos taurus GN=RASA3 PE=2 SV=1 875 1075 2.0E-20
sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus norvegicus GN=Rasa3 PE=1 SV=2 875 1075 3.0E-19
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 873 1124 3.0E-19
sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus musculus GN=Rasa3 PE=1 SV=2 875 1075 3.0E-19
sp|Q14644|RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens GN=RASA3 PE=1 SV=3 875 1075 6.0E-19
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 870 1099 1.0E-18
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 862 1124 2.0E-18
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 862 1124 2.0E-18
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 862 1080 3.0E-17
sp|Q63713|RASA2_RAT Ras GTPase-activating protein 2 OS=Rattus norvegicus GN=Rasa2 PE=2 SV=1 863 1051 1.0E-16
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 870 1099 2.0E-16
sp|P58069|RASA2_MOUSE Ras GTPase-activating protein 2 OS=Mus musculus GN=Rasa2 PE=1 SV=2 873 1043 3.0E-16
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 870 1099 2.0E-15
sp|Q15283|RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens GN=RASA2 PE=1 SV=3 873 1041 5.0E-15
sp|Q22720|GAP1_CAEEL Ras GTPase-activating protein gap-1 OS=Caenorhabditis elegans GN=gap-1 PE=2 SV=1 873 1075 5.0E-10
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 959 1078 2.0E-09
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 941 1043 7.0E-09
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 937 1078 9.0E-09
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 951 1079 8.0E-08
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 941 1079 1.0E-07
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 951 1079 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0050790 regulation of catalytic activity No
GO:0065007 biological regulation No
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3353
MRSSHGMSVPPMQGQVSAAASESGGSSPTADGNAAPLRLATPPIPRVPSQPGSPIAGSRRQGIVFGASYDGLESG
PSSPVQRYHQVRTASSRPRTRTLDTGMLAQRSAPPAHRQRIGSLSSSGPQPVLADDSPQASPPPESEPSAAYQSL
SAHVRQQQQQHHHHHHHHHHHHHHHHQRPSEPSTPTASAPASASSATAKPAAREKEKDKKSSNKRLLRRLSSRPA
SPVAPSMASVDSFAGPVAAAEPAKIISLMSALEGRMRGDVECQVDVGGAWRSGFAFIDDEKGCLVGHPALKGFAG
STLTTLVPDLRGCRVLPVEYPESGRSCLELVAVGQPRQQTEPIILLLRPLSADDWNLWLAALLCWQQVGPPAARA
PHEAESPTTPVTAGSTSSMSSRPALRRQGQSVSSTDGGGGRASSIIKVGTVMLWDKGPAATPYDLLRRSSTRDNT
RLSAASWRRASCILHEDGEFRLLMENGISVLCVIQLSQLSRYAVQLLDNTVLDRQHCLAIFPSYAPSSTHLSIFR
PVYLGLEGRIPLEVWFVLLRAFTVPDVHRLGAPSDEQEDVNVDDTDIGAMFRITRTVGVRVTEAKVRGRPAEEPV
TPVATEKGPKDQLDPLVGDYLAEVIVDDEVRARTTTRPGTRNPFWREDCEFADLPPTVRELAIVLKRVDGKQGEP
SRKGSSSSGYVEVDEAVCGTVNIALDELERGKDHEEWLQISDDRQQPVGSMLVKVSLVEHVALLAKEYEPLSELL
HRFPTGLTTMISTALPGQLRRLAETFLDIFQASGTASGWLMALVEDEIDGIGSQTTMKKFRFGSRLRSSESGESS
SASSAAPAASATHTFPTPPNTAVSTAASSKVTDRELLVRDMSRSLAGEANLLFRGNTLLTQSLEFHMRRLGAEYL
SEVLRDKIVELDELDPDCEVDPSRLPHLHGHHGSHSATAEMDQRWNRLMLLTTEVWRRVADSADRLPAELRLILK
YIRAVAEDRYGDFLRTVTYTAVSGFLFLRFICPAILSPKLFGLLRDHPRPRAQRTLTLIAKVLQKMSNMSVFGKR
EEWMEPMNKFLGAQRPVFRDYIDRVCGIPVESAGVVNQPPSYRTPETILKRLGPDAREGFPSLPYLIDVATSFAS
LVKLWVDSSQGGKVAAAADDDDGDGELLAAFDAICQGLQGKADACLAQAKRSRAMVTAVRGAEQLAESREQATLI
EALSYGPGPTEGGSAERSTGREGGLSASAGGTVKARNGKVGRTILSGIMRMGRAE*
Coding >Ophun1|3353
ATGCGGTCAAGCCATGGCATGAGCGTGCCACCTATGCAAGGACAAGTCTCTGCCGCCGCCTCCGAGAGCGGCGGT
AGCAGCCCGACTGCGGACGGCAATGCCGCTCCTCTACGGCTCGCGACACCGCCCATACCCCGTGTCCCGTCACAG
CCTGGCTCGCCCATCGCCGGCTCCAGGCGGCAGGGCATCGTCTTTGGCGCCTCGTACGACGGCCTCGAATCCGGC
CCGTCGTCTCCCGTCCAGCGCTACCATCAGGTCCGCACCGCCAGCTCCAGGCCTAGGACCCGGACCCTGGACACG
GGCATGCTGGCCCAGAGGAGCGCGCCCCCTGCCCATCGCCAGAGGATAGGCAGCCTGAGCTCGTCGGGCCCGCAG
CCCGTCCTGGCCGACGATTCGCCTCAGGCGTCGCCTCCGCCCGAGTCGGAGCCGTCGGCCGCCTATCAATCCCTG
TCTGCCCATGTTCGACAGCAGCAGCAGCAACACCATCATCATCATCACCATCACCACCACCACCATCACCACCAC
CATCAGCGACCCTCGGAGCCGTCAACGCCGACCGCCTCCGCCCCCGCATCCGCCTCCTCCGCCACCGCCAAGCCG
GCCGCCAGAGAAAAGGAAAAGGACAAAAAGTCGTCCAACAAGCGTCTCCTGCGACGGCTGTCGTCTCGGCCAGCG
TCGCCCGTCGCGCCCTCCATGGCCTCGGTCGACAGCTTCGCCGGTCCCGTCGCCGCGGCCGAGCCCGCCAAAATC
ATCTCCCTCATGAGCGCCTTGGAAGGGAGGATGCGTGGCGACGTCGAATGCCAGGTCGACGTTGGCGGCGCTTGG
CGCTCGGGCTTCGCCTTCATCGACGACGAAAAAGGTTGCCTCGTTGGCCATCCGGCTCTCAAAGGATTCGCCGGC
TCGACCCTGACGACGCTCGTCCCGGACCTCCGCGGCTGCCGCGTCCTGCCCGTCGAGTATCCAGAGTCTGGTCGG
TCGTGCCTCGAATTGGTAGCCGTCGGTCAGCCCAGACAACAGACTGAACCCATCATACTCCTGCTGCGGCCGCTC
TCCGCCGACGACTGGAACCTCTGGCTCGCCGCCCTCCTCTGCTGGCAGCAAGTCGGACCCCCGGCCGCGAGAGCA
CCCCACGAAGCCGAGTCGCCCACGACGCCCGTCACCGCCGGCAGCACCTCGTCCATGAGCTCCCGGCCAGCCCTG
AGAAGACAGGGACAGTCCGTCTCCTCCACCGATGGCGGCGGCGGACGCGCTTCGAGCATCATCAAGGTGGGCACC
GTCATGCTCTGGGACAAAGGGCCGGCCGCGACGCCTTACGACCTCCTCCGCCGGTCTTCCACCCGGGACAATACA
CGCCTCTCGGCCGCCTCGTGGAGGAGAGCGTCGTGCATCCTCCACGAAGACGGCGAGTTCCGGCTACTGATGGAA
AACGGCATCTCGGTCCTGTGCGTCATCCAGCTCTCGCAGCTCTCGCGATACGCCGTCCAGCTGCTCGACAATACC
GTCCTAGACCGCCAACACTGCCTCGCCATATTCCCATCCTACGCTCCCTCGTCGACGCACCTGTCCATATTCCGT
CCCGTCTACCTCGGTCTAGAAGGCCGCATTCCCCTCGAGGTGTGGTTCGTCCTGCTCCGCGCCTTTACCGTGCCC
GACGTCCACCGACTAGGCGCTCCGTCCGACGAGCAGGAAGACGTCAACGTGGACGACACCGACATCGGCGCCATG
TTCCGCATCACCAGAACCGTCGGCGTCAGAGTCACAGAGGCCAAGGTCAGGGGCCGGCCGGCCGAGGAGCCCGTT
ACGCCGGTAGCGACGGAAAAGGGGCCCAAGGACCAGCTGGATCCGCTGGTGGGCGACTACCTGGCCGAGGTCATT
GTCGATGACGAGGTTCGGGCGAGGACGACGACGAGGCCCGGCACGCGCAACCCGTTTTGGAGGGAAGACTGTGAA
TTCGCCGACTTGCCGCCCACGGTGCGGGAGCTTGCCATTGTGCTCAAACGCGTGGACGGCAAGCAGGGCGAGCCC
TCGAGAAAGGGTTCCTCGTCGAGTGGATACGTTGAGGTCGACGAGGCGGTCTGCGGTACCGTCAACATTGCGCTG
GACGAGCTCGAGCGCGGCAAGGACCACGAAGAGTGGCTGCAAATCAGCGACGATCGGCAGCAGCCCGTCGGCTCC
ATGCTGGTCAAGGTGTCGCTCGTCGAGCACGTGGCGTTGCTGGCCAAAGAGTACGAGCCGCTATCGGAACTCTTA
CACCGGTTCCCGACGGGCTTGACGACCATGATTTCGACGGCGCTGCCCGGTCAGTTGCGTCGACTGGCCGAGACG
TTTCTCGACATCTTTCAGGCGTCGGGGACTGCCAGCGGCTGGCTCATGGCTTTGGTGGAAGACGAAATCGACGGC
ATAGGCAGCCAGACGACGATGAAGAAGTTTCGCTTCGGCAGCCGGCTGCGATCGAGCGAGTCGGGCGAGTCGTCT
TCGGCGTCTTCGGCTGCTCCCGCCGCCTCTGCGACGCACACCTTTCCCACGCCTCCCAACACGGCCGTCTCTACG
GCGGCCTCGAGCAAGGTGACGGACCGCGAGCTGCTGGTGCGCGACATGTCGAGGTCGCTGGCGGGCGAGGCCAAT
CTCCTGTTCCGCGGCAACACGTTGCTGACGCAGTCGCTCGAGTTTCATATGCGCCGGCTCGGGGCAGAGTACCTT
TCCGAGGTGCTCCGCGACAAGATTGTCGAGCTGGACGAGCTGGACCCGGACTGCGAGGTGGACCCGAGCCGGCTG
CCTCACCTCCACGGGCATCACGGCTCGCACTCGGCCACGGCTGAAATGGACCAGCGCTGGAACCGGCTGATGCTG
CTGACGACCGAGGTCTGGCGTCGCGTCGCCGATTCCGCGGACCGGCTGCCGGCCGAGCTGCGCCTCATCCTCAAG
TACATCCGGGCCGTGGCCGAGGATCGCTACGGAGACTTTTTGCGCACCGTCACGTACACGGCCGTCTCGGGCTTC
CTGTTCCTCCGCTTCATCTGCCCGGCCATTCTGTCGCCCAAGCTCTTTGGCCTCCTCCGCGACCATCCCCGGCCG
CGGGCCCAGCGGACGCTGACGCTCATCGCCAAGGTGCTGCAGAAAATGTCCAACATGTCCGTCTTTGGCAAGCGA
GAGGAATGGATGGAGCCCATGAACAAGTTTCTCGGCGCTCAGCGTCCCGTCTTTCGCGACTACATCGACCGCGTG
TGCGGCATCCCCGTCGAATCCGCCGGCGTCGTCAACCAGCCGCCCAGCTACCGGACGCCCGAGACGATTCTCAAG
CGGCTCGGCCCCGACGCGCGAGAGGGGTTCCCGAGTCTGCCGTACCTGATCGACGTGGCCACGAGCTTTGCGAGC
CTCGTCAAGTTGTGGGTCGACTCCAGCCAGGGCGGCAAGGTGGCGGCTGCGGCAGACGACGACGACGGCGACGGC
GAGCTGTTGGCTGCCTTTGACGCCATCTGCCAGGGCCTGCAGGGCAAGGCGGACGCCTGTCTCGCGCAGGCGAAG
CGGTCTCGCGCCATGGTGACGGCGGTCCGGGGCGCGGAACAGCTGGCCGAGTCGCGCGAGCAGGCGACCCTCATC
GAGGCGCTGAGCTATGGTCCGGGGCCGACTGAGGGGGGTTCTGCCGAGAGGTCGACGGGCCGTGAGGGCGGGTTG
TCTGCTTCTGCTGGGGGGACGGTCAAGGCGAGGAATGGAAAAGTTGGGAGGACGATTCTCAGTGGGATTATGCGG
ATGGGGAGGGCTGAGTAG
Transcript >Ophun1|3353
ATGCGGTCAAGCCATGGCATGAGCGTGCCACCTATGCAAGGACAAGTCTCTGCCGCCGCCTCCGAGAGCGGCGGT
AGCAGCCCGACTGCGGACGGCAATGCCGCTCCTCTACGGCTCGCGACACCGCCCATACCCCGTGTCCCGTCACAG
CCTGGCTCGCCCATCGCCGGCTCCAGGCGGCAGGGCATCGTCTTTGGCGCCTCGTACGACGGCCTCGAATCCGGC
CCGTCGTCTCCCGTCCAGCGCTACCATCAGGTCCGCACCGCCAGCTCCAGGCCTAGGACCCGGACCCTGGACACG
GGCATGCTGGCCCAGAGGAGCGCGCCCCCTGCCCATCGCCAGAGGATAGGCAGCCTGAGCTCGTCGGGCCCGCAG
CCCGTCCTGGCCGACGATTCGCCTCAGGCGTCGCCTCCGCCCGAGTCGGAGCCGTCGGCCGCCTATCAATCCCTG
TCTGCCCATGTTCGACAGCAGCAGCAGCAACACCATCATCATCATCACCATCACCACCACCACCATCACCACCAC
CATCAGCGACCCTCGGAGCCGTCAACGCCGACCGCCTCCGCCCCCGCATCCGCCTCCTCCGCCACCGCCAAGCCG
GCCGCCAGAGAAAAGGAAAAGGACAAAAAGTCGTCCAACAAGCGTCTCCTGCGACGGCTGTCGTCTCGGCCAGCG
TCGCCCGTCGCGCCCTCCATGGCCTCGGTCGACAGCTTCGCCGGTCCCGTCGCCGCGGCCGAGCCCGCCAAAATC
ATCTCCCTCATGAGCGCCTTGGAAGGGAGGATGCGTGGCGACGTCGAATGCCAGGTCGACGTTGGCGGCGCTTGG
CGCTCGGGCTTCGCCTTCATCGACGACGAAAAAGGTTGCCTCGTTGGCCATCCGGCTCTCAAAGGATTCGCCGGC
TCGACCCTGACGACGCTCGTCCCGGACCTCCGCGGCTGCCGCGTCCTGCCCGTCGAGTATCCAGAGTCTGGTCGG
TCGTGCCTCGAATTGGTAGCCGTCGGTCAGCCCAGACAACAGACTGAACCCATCATACTCCTGCTGCGGCCGCTC
TCCGCCGACGACTGGAACCTCTGGCTCGCCGCCCTCCTCTGCTGGCAGCAAGTCGGACCCCCGGCCGCGAGAGCA
CCCCACGAAGCCGAGTCGCCCACGACGCCCGTCACCGCCGGCAGCACCTCGTCCATGAGCTCCCGGCCAGCCCTG
AGAAGACAGGGACAGTCCGTCTCCTCCACCGATGGCGGCGGCGGACGCGCTTCGAGCATCATCAAGGTGGGCACC
GTCATGCTCTGGGACAAAGGGCCGGCCGCGACGCCTTACGACCTCCTCCGCCGGTCTTCCACCCGGGACAATACA
CGCCTCTCGGCCGCCTCGTGGAGGAGAGCGTCGTGCATCCTCCACGAAGACGGCGAGTTCCGGCTACTGATGGAA
AACGGCATCTCGGTCCTGTGCGTCATCCAGCTCTCGCAGCTCTCGCGATACGCCGTCCAGCTGCTCGACAATACC
GTCCTAGACCGCCAACACTGCCTCGCCATATTCCCATCCTACGCTCCCTCGTCGACGCACCTGTCCATATTCCGT
CCCGTCTACCTCGGTCTAGAAGGCCGCATTCCCCTCGAGGTGTGGTTCGTCCTGCTCCGCGCCTTTACCGTGCCC
GACGTCCACCGACTAGGCGCTCCGTCCGACGAGCAGGAAGACGTCAACGTGGACGACACCGACATCGGCGCCATG
TTCCGCATCACCAGAACCGTCGGCGTCAGAGTCACAGAGGCCAAGGTCAGGGGCCGGCCGGCCGAGGAGCCCGTT
ACGCCGGTAGCGACGGAAAAGGGGCCCAAGGACCAGCTGGATCCGCTGGTGGGCGACTACCTGGCCGAGGTCATT
GTCGATGACGAGGTTCGGGCGAGGACGACGACGAGGCCCGGCACGCGCAACCCGTTTTGGAGGGAAGACTGTGAA
TTCGCCGACTTGCCGCCCACGGTGCGGGAGCTTGCCATTGTGCTCAAACGCGTGGACGGCAAGCAGGGCGAGCCC
TCGAGAAAGGGTTCCTCGTCGAGTGGATACGTTGAGGTCGACGAGGCGGTCTGCGGTACCGTCAACATTGCGCTG
GACGAGCTCGAGCGCGGCAAGGACCACGAAGAGTGGCTGCAAATCAGCGACGATCGGCAGCAGCCCGTCGGCTCC
ATGCTGGTCAAGGTGTCGCTCGTCGAGCACGTGGCGTTGCTGGCCAAAGAGTACGAGCCGCTATCGGAACTCTTA
CACCGGTTCCCGACGGGCTTGACGACCATGATTTCGACGGCGCTGCCCGGTCAGTTGCGTCGACTGGCCGAGACG
TTTCTCGACATCTTTCAGGCGTCGGGGACTGCCAGCGGCTGGCTCATGGCTTTGGTGGAAGACGAAATCGACGGC
ATAGGCAGCCAGACGACGATGAAGAAGTTTCGCTTCGGCAGCCGGCTGCGATCGAGCGAGTCGGGCGAGTCGTCT
TCGGCGTCTTCGGCTGCTCCCGCCGCCTCTGCGACGCACACCTTTCCCACGCCTCCCAACACGGCCGTCTCTACG
GCGGCCTCGAGCAAGGTGACGGACCGCGAGCTGCTGGTGCGCGACATGTCGAGGTCGCTGGCGGGCGAGGCCAAT
CTCCTGTTCCGCGGCAACACGTTGCTGACGCAGTCGCTCGAGTTTCATATGCGCCGGCTCGGGGCAGAGTACCTT
TCCGAGGTGCTCCGCGACAAGATTGTCGAGCTGGACGAGCTGGACCCGGACTGCGAGGTGGACCCGAGCCGGCTG
CCTCACCTCCACGGGCATCACGGCTCGCACTCGGCCACGGCTGAAATGGACCAGCGCTGGAACCGGCTGATGCTG
CTGACGACCGAGGTCTGGCGTCGCGTCGCCGATTCCGCGGACCGGCTGCCGGCCGAGCTGCGCCTCATCCTCAAG
TACATCCGGGCCGTGGCCGAGGATCGCTACGGAGACTTTTTGCGCACCGTCACGTACACGGCCGTCTCGGGCTTC
CTGTTCCTCCGCTTCATCTGCCCGGCCATTCTGTCGCCCAAGCTCTTTGGCCTCCTCCGCGACCATCCCCGGCCG
CGGGCCCAGCGGACGCTGACGCTCATCGCCAAGGTGCTGCAGAAAATGTCCAACATGTCCGTCTTTGGCAAGCGA
GAGGAATGGATGGAGCCCATGAACAAGTTTCTCGGCGCTCAGCGTCCCGTCTTTCGCGACTACATCGACCGCGTG
TGCGGCATCCCCGTCGAATCCGCCGGCGTCGTCAACCAGCCGCCCAGCTACCGGACGCCCGAGACGATTCTCAAG
CGGCTCGGCCCCGACGCGCGAGAGGGGTTCCCGAGTCTGCCGTACCTGATCGACGTGGCCACGAGCTTTGCGAGC
CTCGTCAAGTTGTGGGTCGACTCCAGCCAGGGCGGCAAGGTGGCGGCTGCGGCAGACGACGACGACGGCGACGGC
GAGCTGTTGGCTGCCTTTGACGCCATCTGCCAGGGCCTGCAGGGCAAGGCGGACGCCTGTCTCGCGCAGGCGAAG
CGGTCTCGCGCCATGGTGACGGCGGTCCGGGGCGCGGAACAGCTGGCCGAGTCGCGCGAGCAGGCGACCCTCATC
GAGGCGCTGAGCTATGGTCCGGGGCCGACTGAGGGGGGTTCTGCCGAGAGGTCGACGGGCCGTGAGGGCGGGTTG
TCTGCTTCTGCTGGGGGGACGGTCAAGGCGAGGAATGGAAAAGTTGGGAGGACGATTCTCAGTGGGATTATGCGG
ATGGGGAGGGCTGAGTAG
Gene >Ophun1|3353
ATGCGGTCAAGCCATGGCATGAGCGTGCCACCTATGCAAGGACAAGTCTCTGCCGCCGCCTCCGAGAGCGGCGGT
AGCAGCCCGACTGCGGACGGCAATGCCGCTCCTCTACGGCTCGCGACACCGCCCATACCCCGTGTCCCGTCACAG
CCTGGCTCGCCCATCGCCGGCTCCAGGCGGCAGGGCATCGTCTTTGGCGCCTCGTACGACGGCCTCGAATCCGGC
CCGTCGTCTCCCGTCCAGCGCTACCATCAGGTCCGCACCGCCAGCTCCAGGCCTAGGACCCGGACCCTGGACACG
GGCATGCTGGCCCAGAGGAGCGCGCCCCCTGCCCATCGCCAGAGGATAGGCAGCCTGAGCTCGTCGGGCCCGCAG
CCCGTCCTGGCCGACGATTCGCCTCAGGCGTCGCCTCCGCCCGAGTCGGAGCCGTCGGCCGCCTATCAATCCCTG
TCTGCCCATGTTCGACAGCAGCAGCAGCAACACCATCATCATCATCACCATCACCACCACCACCATCACCACCAC
CATCAGCGACCCTCGGAGCCGTCAACGCCGACCGCCTCCGCCCCCGCATCCGCCTCCTCCGCCACCGCCAAGCCG
GCCGCCAGAGAAAAGGAAAAGGACAAAAAGTCGTCCAACAAGCGTCTCCTGCGACGGCTGTCGTCTCGGCCAGCG
TCGCCCGTCGCGCCCTCCATGGCCTCGGTCGACAGCTTCGCCGGTCCCGTCGCCGCGGCCGAGCCCGCCAAAATC
ATCTCCCTCATGAGCGCCTTGGAAGGGAGGATGCGTGGCGACGTCGAATGCCAGGTCGACGTTGGCGGCGCTTGG
CGCTCGGGCTTCGCCTTCATCGACGACGAAAAAGGTTGCCTCGTTGGCCATCCGGCTCTCAAAGGATTCGCCGGC
TCGACCCTGACGACGCTCGTCCCGGACCTCCGCGGCTGCCGCGTCCTGCCCGTCGAGTATCCAGAGTCTGGTCGG
TCGTGCCTCGAATTGGTAGCCGTCGGTCAGCCCAGACAACAGACTGAACCCATCATACTCCTGCTGCGGCCGCTC
TCCGCCGACGACTGGAACCTCTGGCTCGCCGCCCTCCTCTGCTGGCAGCAAGTCGGACCCCCGGCCGCGAGAGCA
CCCCACGAAGCCGAGTCGCCCACGACGCCCGTCACCGCCGGCAGCACCTCGTCCATGAGCTCCCGGCCAGCCCTG
AGAAGACAGGGACAGTCCGTCTCCTCCACCGATGGCGGCGGCGGACGCGCTTCGAGCATCATCAAGGTGGGCACC
GTCATGCTCTGGGACAAAGGGCCGGCCGCGACGCCTTACGACCTCCTCCGCCGGTCTTCCACCCGGGACAATACA
CGCCTCTCGGCCGCCTCGTGGAGGAGAGCGTCGTGCATCCTCCACGAAGACGGCGAGTTCCGGCTACTGATGGAA
AACGGCATCTCGGTCCTGTGCGTCATCCAGCTCTCGCAGCTCTCGCGATACGCCGTCCAGCTGCTCGACAATACC
GTCCTAGACCGCCAACACTGCCTCGCCATATTCCCATCCTACGCTCCCTCGTCGACGCACCTGTCCATATTCCGT
CCCGTCTACCTCGGTCTAGAAGGCCGCATTCCCCTCGAGGTGTGGTTCGTCCTGCTCCGCGCCTTTACCGTGCCC
GACGTCCACCGACTAGGCGCTCCGTCCGACGAGCAGGAAGACGTCAACGTGGACGACACCGACATCGGCGCCATG
TTCCGCATCACCAGAACCGTCGGCGTCAGAGTCACAGAGGCCAAGGTCAGGGGCCGGCCGGCCGAGGAGCCCGTT
ACGCCGGTAGCGACGGAAAAGGGGCCCAAGGACCAGCTGGATCCGCTGGTGGGCGACTACCTGGCCGAGGTCATT
GTCGATGACGAGGTTCGGGCGAGGACGACGACGAGGCCCGGCACGCGCAACCCGTTTTGGAGGGAAGACTGTGAA
TTCGCCGACTTGCCGCCCACGGTGCGGGAGCTTGCCATTGTGCTCAAACGCGTGGACGGCAAGCAGGGCGAGCCC
TCGAGAAAGGGTTCCTCGTCGAGTGGATACGTTGAGGTCGACGAGGCGGTCTGCGGTACCGTCAACATTGCGCTG
GACGAGCTCGAGCGCGGCAAGGACCACGAAGAGTGGCTGCAAATCAGCGACGATCGGCAGCAGCCCGTCGGCTCC
ATGCTGGTCAAGGTGTCGCTCGTCGAGCACGTGGCGTTGCTGGCCAAAGAGTACGAGCCGCTATCGGAACTCTTA
CACCGGTTCCCGACGGGCTTGACGACCATGATTTCGACGGCGCTGCCCGGTCAGTTGCGTCGACTGGCCGAGACG
TTTCTCGACATCTTTCAGGCGTCGGGGACTGCCAGCGGCTGGCTCATGGCTTTGGTGGAAGACGAAATCGACGGC
ATAGGCAGCCAGACGACGATGAAGAAGTTTCGCTTCGGCAGCCGGCTGCGATCGAGCGAGTCGGGCGAGTCGTCT
TCGGCGTCTTCGGCTGCTCCCGCCGCCTCTGCGACGCACACCTTTCCCACGCCTCCCAACACGGCCGTCTCTACG
GCGGCCTCGAGCAAGGTGACGGACCGCGAGCTGCTGGTGCGCGACATGTCGAGGTCGCTGGCGGGCGAGGCCAAT
CTCCTGTTCCGCGGCAACACGTTGCTGACGCAGTCGCTCGAGTTTCATATGCGCCGGCTCGGGGCAGAGTACCTT
TCCGAGGTGCTCCGCGACAAGATTGTCGAGCTGGACGAGCTGGACCCGGACTGCGAGGTGGACCCGAGCCGGCTG
CCTCACCTCCACGGGCATCACGGCTCGCACTCGGCCACGGCTGAAATGGACCAGCGCTGGAACCGGCTGATGCTG
CTGACGACCGAGGTCTGGCGTCGCGTCGCCGATTCCGCGGACCGGCTGCCGGCCGAGCTGCGCCTCATCCTCAAG
TACATCCGGGCCGTGGCCGAGGATCGCTACGGAGACTTTTTGCGCACCGTCACGTACACGGCCGTCTCGGGCTTC
CTGTTCCTCCGCTTCATCTGCCCGGCCATTCTGTCGCCCAAGCTCTTTGGCCTCCTCCGCGACCATCCCCGGCCG
CGGGCCCAGCGGACGCTGACGCTCATCGCCAAGGTGCTGCAGAAAATGTCCAACATGTCCGTCTTTGGCAAGCGA
GAGGAATGGATGGAGCCCATGAACAAGTTTCTCGGCGCTCAGCGTCCCGTCTTTCGCGACTACATCGACCGCGTG
TGCGGCATCCCCGTCGAATCCGCCGGCGTCGTCAACCAGCCGCCCAGCTACCGGACGCCCGAGACGATTCTCAAG
CGGCTCGGCCCCGACGCGCGAGAGGGGTTCCCGAGTCTGCCGTACCTGATCGACGTGGCCACGAGCTTTGCGAGC
CTCGTCAAGTTGTGGGTCGACTCCAGCCAGGGCGGCAAGGTGGCGGCTGCGGCAGACGACGACGACGGCGACGGC
GAGCTGTTGGCTGCCTTTGACGCCATCTGCCAGGGCCTGCAGGGCAAGGCGGACGCCTGTCTCGCGCAGGCGAAG
CGGTCTCGCGCCATGGTGACGGCGGTCCGGGGCGCGGAACAGCTGGCCGAGTCGCGCGAGCAGGCGACCCTCATC
GAGGCGCTGAGCTATGGTCCGGGGCCGACTGAGGGGGGTTCTGCCGAGAGGTCGACGGGCCGTGAGGGCGGGTTG
TCTGCTTCTGCTGGGGGGACGGTCAAGGCGAGGAATGGAAAAGTTGGGAGGACGATTCTCAGTGGGATTATGCGG
ATGGGGAGGGCTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail