Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3335
Gene name
LocationContig_299:6426..8296
Strand+
Gene length (bp)1870
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 5.0E-06 344 450

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8D3Q3|SPEE_VIBVU Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=speE PE=3 SV=1 337 451 8.0E-09
sp|Q7MF74|SPEE_VIBVY Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain YJ016) GN=speE PE=3 SV=1 337 451 9.0E-09
sp|Q6NTR1|MET13_XENLA Methyltransferase-like protein 13 OS=Xenopus laevis GN=mettl13 PE=2 SV=1 340 538 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 88 110 22
3 117 139 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3335
MPAKSASKVPAKPSTPAPAGGFTPERFEAELKGLAAKARDDSSGKRVVEQLFLFAKAALLLALLGVYSFVSPLYL
SPVYGSLPASLWHSRLLMVGCFIGWAGNVAFRNLLPVRTTKLLPLVAVYIPTVQWFLVGYSSLLGPRWGPLFTEG
VTLMPLAVLTAASVADLFEDARLPLLPGFIAEAAPGIGSWAWLKFVELQASRHLLPNMGRLIPLTRLGLELMLGA
VYAVLDRSKLLLYVLPPLMHTMVFNTHLSSPAATSRLVSSMLSDDWLLLERRESLTGYVSVVQSLDRGFRAMRCD
HSILGGDWINERGRALSEPIYGVFVMLEAVRLAERDDPPPDKEARALVVGLGVGTTPSTLVTHGINTTVVEIDPV
VHEFAVKYFNLKENNPPILEDAVSYTSSLTETAPQSYDYIIHDVFTGGAEPVQLFTLEFLQSLERLLKPNGVIAI
NYAGDLALPPPAIIMRTIKRVFPTCRVFREVPPDAKAIELDGADFANMAIFCTKSSSPLKFRSPTPADHLESETR
KMFLTLDNEMLESEILSRHEDDTTVLLRNDTSAVEKWHEQGALGHWAIMRRMLPASVWERW*
Coding >Ophun1|3335
ATGCCGGCCAAAAGTGCGAGCAAGGTGCCGGCTAAGCCGTCGACTCCGGCTCCGGCTGGCGGCTTCACTCCCGAA
CGCTTCGAAGCTGAGCTCAAAGGCCTCGCCGCCAAAGCCAGGGACGATTCTTCGGGCAAACGCGTCGTCGAGCAG
CTGTTTCTTTTCGCAAAGGCAGCTCTCCTGCTGGCCCTCCTTGGCGTCTACTCCTTCGTCTCGCCCCTATACCTG
TCGCCCGTCTACGGATCGCTGCCGGCCTCGCTATGGCATTCTCGCCTTCTCATGGTTGGCTGCTTCATCGGATGG
GCGGGAAACGTGGCCTTTCGAAACCTGCTCCCCGTCAGGACGACGAAACTACTTCCGCTCGTCGCTGTTTACATT
CCGACCGTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTCTTCACCGAGGGC
GTTACCTTGATGCCCCTTGCTGTCTTGACTGCCGCTTCCGTCGCCGATCTCTTCGAGGATGCGCGACTACCTCTA
CTGCCGGGATTCATCGCCGAGGCCGCTCCGGGTATCGGTTCATGGGCTTGGCTCAAGTTTGTCGAGCTGCAGGCC
AGCCGCCATCTGCTGCCCAACATGGGCCGTCTCATACCTCTCACCCGTCTCGGCTTGGAACTGATGTTGGGCGCC
GTGTATGCCGTCTTGGACCGCTCCAAGCTTCTGCTGTATGTGCTGCCTCCGCTGATGCACACCATGGTTTTCAAC
ACACACCTCTCCTCGCCGGCCGCCACCTCACGGCTCGTCAGCTCCATGCTGTCAGACGACTGGCTGCTGCTGGAG
CGCCGAGAGTCCCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTAGACCGAGGCTTCCGCGCCATGCGCTGCGAC
CACAGCATCCTGGGCGGCGACTGGATCAACGAGCGTGGTCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTTGTC
ATGCTTGAGGCTGTGCGACTAGCAGAGAGGGACGACCCACCGCCGGATAAGGAGGCACGCGCTCTGGTTGTCGGG
CTCGGCGTGGGTACGACGCCTTCGACTCTCGTCACCCACGGCATCAATACGACAGTCGTCGAGATCGACCCGGTC
GTGCACGAGTTTGCCGTCAAGTACTTTAATCTCAAGGAGAACAACCCTCCCATCTTGGAGGATGCCGTGAGCTAC
ACCTCGTCTCTAACGGAAACCGCCCCCCAAAGTTACGACTACATCATTCACGACGTCTTCACCGGCGGCGCCGAA
CCTGTGCAGTTGTTCACCCTAGAGTTTCTTCAGAGCTTGGAGAGGTTGCTGAAGCCAAATGGAGTCATTGCCATT
AACTACGCCGGCGACCTCGCTTTACCCCCTCCTGCCATCATCATGCGCACCATCAAGCGTGTCTTCCCGACATGT
CGCGTCTTCCGCGAGGTGCCCCCTGACGCAAAGGCCATTGAGCTCGACGGAGCCGACTTTGCCAACATGGCCATC
TTTTGCACAAAGTCTAGCTCTCCGCTGAAGTTTAGGAGCCCTACGCCGGCCGACCATCTGGAGAGCGAGACGAGG
AAAATGTTTCTCACCTTGGATAACGAGATGCTCGAGTCTGAGATTCTGTCACGGCATGAAGACGATACGACTGTC
TTGCTGAGGAACGATACTAGCGCGGTGGAGAAGTGGCATGAGCAGGGCGCGCTGGGTCACTGGGCTATAATGCGG
AGGATGCTGCCGGCTTCTGTGTGGGAGCGGTGGTGA
Transcript >Ophun1|3335
ATGCCGGCCAAAAGTGCGAGCAAGGTGCCGGCTAAGCCGTCGACTCCGGCTCCGGCTGGCGGCTTCACTCCCGAA
CGCTTCGAAGCTGAGCTCAAAGGCCTCGCCGCCAAAGCCAGGGACGATTCTTCGGGCAAACGCGTCGTCGAGCAG
CTGTTTCTTTTCGCAAAGGCAGCTCTCCTGCTGGCCCTCCTTGGCGTCTACTCCTTCGTCTCGCCCCTATACCTG
TCGCCCGTCTACGGATCGCTGCCGGCCTCGCTATGGCATTCTCGCCTTCTCATGGTTGGCTGCTTCATCGGATGG
GCGGGAAACGTGGCCTTTCGAAACCTGCTCCCCGTCAGGACGACGAAACTACTTCCGCTCGTCGCTGTTTACATT
CCGACCGTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTCTTCACCGAGGGC
GTTACCTTGATGCCCCTTGCTGTCTTGACTGCCGCTTCCGTCGCCGATCTCTTCGAGGATGCGCGACTACCTCTA
CTGCCGGGATTCATCGCCGAGGCCGCTCCGGGTATCGGTTCATGGGCTTGGCTCAAGTTTGTCGAGCTGCAGGCC
AGCCGCCATCTGCTGCCCAACATGGGCCGTCTCATACCTCTCACCCGTCTCGGCTTGGAACTGATGTTGGGCGCC
GTGTATGCCGTCTTGGACCGCTCCAAGCTTCTGCTGTATGTGCTGCCTCCGCTGATGCACACCATGGTTTTCAAC
ACACACCTCTCCTCGCCGGCCGCCACCTCACGGCTCGTCAGCTCCATGCTGTCAGACGACTGGCTGCTGCTGGAG
CGCCGAGAGTCCCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTAGACCGAGGCTTCCGCGCCATGCGCTGCGAC
CACAGCATCCTGGGCGGCGACTGGATCAACGAGCGTGGTCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTTGTC
ATGCTTGAGGCTGTGCGACTAGCAGAGAGGGACGACCCACCGCCGGATAAGGAGGCACGCGCTCTGGTTGTCGGG
CTCGGCGTGGGTACGACGCCTTCGACTCTCGTCACCCACGGCATCAATACGACAGTCGTCGAGATCGACCCGGTC
GTGCACGAGTTTGCCGTCAAGTACTTTAATCTCAAGGAGAACAACCCTCCCATCTTGGAGGATGCCGTGAGCTAC
ACCTCGTCTCTAACGGAAACCGCCCCCCAAAGTTACGACTACATCATTCACGACGTCTTCACCGGCGGCGCCGAA
CCTGTGCAGTTGTTCACCCTAGAGTTTCTTCAGAGCTTGGAGAGGTTGCTGAAGCCAAATGGAGTCATTGCCATT
AACTACGCCGGCGACCTCGCTTTACCCCCTCCTGCCATCATCATGCGCACCATCAAGCGTGTCTTCCCGACATGT
CGCGTCTTCCGCGAGGTGCCCCCTGACGCAAAGGCCATTGAGCTCGACGGAGCCGACTTTGCCAACATGGCCATC
TTTTGCACAAAGTCTAGCTCTCCGCTGAAGTTTAGGAGCCCTACGCCGGCCGACCATCTGGAGAGCGAGACGAGG
AAAATGTTTCTCACCTTGGATAACGAGATGCTCGAGTCTGAGATTCTGTCACGGCATGAAGACGATACGACTGTC
TTGCTGAGGAACGATACTAGCGCGGTGGAGAAGTGGCATGAGCAGGGCGCGCTGGGTCACTGGGCTATAATGCGG
AGGATGCTGCCGGCTTCTGTGTGGGAGCGGTGGTGA
Gene >Ophun1|3335
ATGCCGGCCAAAAGTGCGAGCAAGGTGCCGGCTAAGCCGTCGACTCCGGCTCCGGCTGGCGGCTTCACTCCCGAA
CGCTTCGAAGCTGAGCTCAAAGGCCTCGCCGCCAAAGCCAGGGACGATTCTTCGGGCAAACGCGTCGTCGAGCAG
CTGTTTCTTTTCGCAAAGGCAGCTCTCCTGCTGGCCCTCCTTGGCGTCTACTCCTTCGTCTCGCCCCTATACCTG
TCGCCCGTCTACGGATCGCTGCCGGCCTCGCTATGGCATTCTCGCCTTCTCATGGTTGGCTGCTTCATCGGATGG
GCGGGAAACGTGGCCTTTCGAAACCTGCTCCCCGTCAGGACGACGAAACTACTTCCGCTCGTCGCTGTTTACATT
CCGACCGTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTCTTCACCGAGGGC
GTTACCTTGATGCCCCTTGCTGTCTTGACTGCCGCTTCCGTCGCCGATCTCTTCGAGGATGCGCGACTACCTCTA
CTGCCGGGATTCATCGCCGAGGCCGCTCCGGGTATCGGTTCATGGGCTTGGCTCAAGTTTGTCGAGCTGCAGGCC
AGCCGCCATCTGCTGCCCAACATGGGCCGTCTCATACCTCTCACCCGTCTCGGCTTGGAACTGATGTTGGGCGCC
GTGTATGCCGTCTTGGACCGCTCCAAGCTTCTGCTGTATGTGCTGCCTCCGCTGATGCACACCATGGTTTTCAAC
ACACACCTCTCCTCGCCGGCCGCCACCTCACGGCTCGTCAGCTCCATGCTGTCAGACGACTGGCTGCTGCTGGAG
CGCCGAGAGTCCCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTAGACCGAGGCTTCCGCGCCATGCGCTGCGAC
CACAGCATCCTGGGCGGCGACTGGATCAACGAGCGTGGTCGCGCGCTGTCGGAGCCCATCTACGGCGTCTTTGTC
ATGCTTGAGGCTGTGCGACTAGCAGAGAGGGACGACCCACCGCCGGATAAGGAGGCACGCGCTCTGGTTGTGTAA
GTTGCGGCTCTGACTCTTGTAAGCTGGCGTCGGTGCTGACGGGACACAGCGGGCTCGGCGTGGGTACGACGCCTT
CGACTCTCGTCACCCACGGCATCAATACGACAGTCGTCGAGATCGACCCGGTCGTGCACGAGTTTGCCGTCAAGT
ACTTTAATCTCAAGGAGAACAACCCTCCCATCTTGGAGGATGCCGTGAGCTACACCTCGTCTCTAACGGAAACCG
CCCCCCAAAGTTACGACTACATCATTCACGACGTCTTCACCGGCGGCGCCGAACCTGTGCAGTTGTTCACCCTAG
AGTTTCTTCAGAGCTTGGAGAGGTTGCTGAAGCCAAATGGAGTCATTGCCATTGTGAGTGGCCCGTCCGTGAGCG
AACTCGGATATAGGAGTCTAACGCTTGTCTGCAGAACTACGCCGGCGACCTCGCTTTACCCCCTCCTGCCATCAT
CATGCGCACCATCAAGCGTGTCTTCCCGACATGTCGCGTCTTCCGCGAGGTGCCCCCTGACGCAAAGGCCATTGA
GCTCGACGGAGCCGACTTTGCCAACATGGCCATCTTTTGCACAAAGTCTAGCTCTCCGCTGAAGTTTAGGAGCCC
TACGCCGGCCGACCATCTGGAGAGCGAGACGAGGAAAATGTTTCTCACCTTGGATAACGAGATGCTCGAGTCTGA
GATTCTGTCACGGCATGAAGACGATACGACTGTCTTGCTGAGGAACGATACTAGCGCGGTGGAGAAGTGGCATGA
GCAGGGCGCGCTGGGTCACTGGGCTATAATGCGGAGGATGCTGCCGGCTTCTGTGTGGGAGCGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail