Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3333
Gene name
LocationContig_298:18017..22035
Strand+
Gene length (bp)4018
Transcript length (bp)3837
Coding sequence length (bp)3837
Protein length (aa) 1279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 1.2E-15 911 997
PF06292 MUN MUN domain 1.0E-10 702 832

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 42 1249 1.0E-92
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 453 1229 6.0E-49
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 445 1182 2.0E-15
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 898 995 7.0E-12
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 869 1013 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 42 1249 1.0E-92
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 453 1229 6.0E-49
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 445 1182 2.0E-15
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 898 995 7.0E-12
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 869 1013 3.0E-10
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 910 1024 1.0E-09
sp|A3KGK3|FR1L4_MOUSE Fer-1-like protein 4 OS=Mus musculus GN=Fer1l4 PE=2 SV=3 905 996 5.0E-09
sp|A9Z1Z3|FR1L4_HUMAN Fer-1-like protein 4 OS=Homo sapiens GN=FER1L4 PE=2 SV=1 905 996 1.0E-08
sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 911 1012 2.0E-08
sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 911 1012 2.0E-08
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 911 1024 3.0E-08
sp|Q54FM6|Y0753_DICDI C2 domain-containing protein DDB_G0290753 OS=Dictyostelium discoideum GN=DDB_G0290753 PE=3 SV=1 872 1003 7.0E-08
sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 911 1013 8.0E-08
sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 911 1012 1.0E-07
sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 913 991 1.0E-07
sp|Q9LP65|CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5 OS=Arabidopsis thaliana GN=CAR5 PE=2 SV=1 910 997 2.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 911 993 2.0E-07
sp|P24505|SY61_DIPOM Synaptotagmin-A OS=Diplobatis ommata GN=P65-A PE=2 SV=1 911 1012 4.0E-07
sp|O75923|DYSF_HUMAN Dysferlin OS=Homo sapiens GN=DYSF PE=1 SV=1 907 1012 4.0E-07
sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=4 913 1015 5.0E-07
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 881 993 7.0E-07
sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 913 1012 1.0E-06
sp|Q9LVH4|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 OS=Arabidopsis thaliana GN=CAR4 PE=1 SV=1 930 997 1.0E-06
sp|A0A075F932|SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoid GN=SYT1 PE=2 SV=1 913 1012 1.0E-06
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 910 995 2.0E-06
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 901 995 2.0E-06
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 911 993 2.0E-06
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 911 1016 2.0E-06
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 911 1012 2.0E-06
sp|A6QQP7|DYSF_BOVIN Dysferlin OS=Bos taurus GN=DYSF PE=2 SV=1 907 994 2.0E-06
sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 913 1012 3.0E-06
sp|P70611|DOC2A_RAT Double C2-like domain-containing protein alpha OS=Rattus norvegicus GN=Doc2a PE=1 SV=1 908 993 3.0E-06
sp|Q14183|DOC2A_HUMAN Double C2-like domain-containing protein alpha OS=Homo sapiens GN=DOC2A PE=1 SV=5 913 1012 3.0E-06
sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 913 1012 3.0E-06
sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 913 1012 3.0E-06
sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 913 1012 3.0E-06
sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 911 1012 3.0E-06
sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 913 1012 3.0E-06
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 913 1012 3.0E-06
sp|Q9ESD7|DYSF_MOUSE Dysferlin OS=Mus musculus GN=Dysf PE=1 SV=3 907 1012 4.0E-06
sp|Q7TNF0|DOC2A_MOUSE Double C2-like domain-containing protein alpha OS=Mus musculus GN=Doc2a PE=2 SV=1 908 993 4.0E-06
sp|Q2WGJ9|FR1L6_HUMAN Fer-1-like protein 6 OS=Homo sapiens GN=FER1L6 PE=2 SV=2 906 1037 5.0E-06
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 913 995 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3333
MSTASRQSQGANLSNASRNSRPPSRRPRHVPSRTRSSIHHLAVEHDVARSFALRTAYLHHLLQPRPKRKQYVATP
KQRSYTSVTQLLHEYVSGSSSSLKLPHAFATQLLDRVGGVVRGSETLPGFNDAAVKRSFAEAYTAFSEKAFRKSI
DKERKFEPLVLIFYSAATKSAQKGRLPDDDSWKILPDRHLALFLRLAADILRNHGHDRDRPDLMSRLLTLESKIL
TNDQNLFETGPDAAGTAVEVAVPLTYGVKDMPMVQIVAAIFGLSQSEVQAEIDDKRSVWTEEAALRDLKSYQLRL
NSDKPGALRSQDFDSVDAFNDWKKSEAPHLSQMMLEILTVKPELAKRSTARAEKTSASRPQSLYLDDTVCVSPTR
PVSMFGDGLAGFDSLSIDSDASINEPIYTFIPPNPIAFYKYIIQHAMAFDQLHADPELDYQPLSKQSMELATELC
VRWRIPQSARLIALLAVATRKFVDREIVPTELDAIFDLVKSPLSEVKKPPHITQYAAALTDIDPNRWTVDDFAVY
RGTLHTLHDTLLRELYDLLGQCYDAKPPDIAAIMFLLENHIGSDPVFSPSPAAYVEFSDQLAQGLARRAADVYRE
YMEKEIPAHKEEWEFGHVVKLGKSVTKLCDRIRKRYRNTPEIMGVNPLGILVAEVLPSFEGDAGAIVEAILSGAA
ETGDEVEIQEGFELYKELVEIRRVHQQSLPEVPFAVNVEDLLSSFVWRWIRNAEERIPEFVDQAIKQDQFQVRAE
GPDQAARDSERHSVSVIDLFMLFNQTVGQIFALEWGNEVHHAKFMTAIARIITTGIGLYCDAVEQRFAKEMDRLS
ADELAVQTKTAQERWMQMAKDAWSNKEKVEPFQFYPESFVKLNNIEYAMQELDKLEKSMDSEACALVLQHMESPR
AKARKPSKYIFTIKVVEAEDVKACDPNGYSDPYVVFGDEYQKRLHKTRVIHRSLNPRWDESFEITVQGPINVIAT
IWDHDTFGDHDYVGRTALKLDPAHFGDYLPRELWLDLDLQGRLLMRVSMEGERDDIEFHFGKAFRHLKRTERDMV
RKVTDKLITHITATLSPETVRGVLGHGGVLGASVTNLWKKRAAKTPTTTVSQVEGALAPLFTYFDENFAIMKQTL
TEATMTAVMTRLWKEVLMAIENLLVPPLSEKPSTKKPLTRRELDVVYHWLEMLFTFFNARDEDSGEQLGVPGEVL
KSPKWHELASLNFFYLEDTSSLIGESERMATAAALRAQQALQQNRMSAPAGLGSGLGSLAGMGTIKRGKSLRRSR
ATT*
Coding >Ophun1|3333
ATGTCGACAGCCTCGCGTCAGTCCCAGGGAGCCAACCTCTCCAACGCCTCGCGCAACTCTCGACCACCCAGTCGT
CGCCCTCGCCATGTCCCGTCCAGGACACGCTCCTCGATCCATCACCTGGCCGTCGAGCACGACGTCGCCCGCAGC
TTCGCCCTACGCACCGCCTATCTCCATCATCTCCTGCAGCCCCGGCCCAAGCGGAAGCAATACGTGGCTACGCCG
AAGCAACGATCCTATACCTCAGTCACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAGCTGCTCGACCGTGTTGGCGGCGTCGTCCGCGGCAGTGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCTCTCGTCCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGTCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTTCGCAACCATGGCCACGACCGCGACCGGCCGGACCTCATGTCGAGGCTGCTCACGCTCGAGAGCAAGATTCTC
ACAAACGACCAGAACCTATTCGAGACGGGCCCCGACGCTGCCGGCACCGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGCCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAGCGCTCCGTCTGGACAGAAGAGGCAGCTCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGCGCGCTGAGGAGTCAAGACTTTGACAGCGTCGACGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGAGATTCTGACTGTCAAGCCAGAGTTGGCCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCGAGTCGGCCCCAGTCGCTATACCTCGACGACACGGTCTGTGTGAGTCCAACCCGG
CCCGTGTCCATGTTTGGAGACGGCCTGGCTGGCTTCGACTCCCTGTCAATCGACTCGGACGCGAGTATAAACGAG
CCCATCTACACATTCATCCCTCCCAACCCCATCGCCTTCTATAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGTTGGCGACGGAGCTCTGT
GTGCGATGGCGCATTCCCCAGTCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCAACCCGTAAGTTTGTGGATCGC
GAGATTGTGCCTACCGAGCTGGATGCCATCTTCGACCTGGTCAAGTCACCTCTGTCAGAGGTTAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACCGACATCGACCCGAACAGGTGGACCGTCGACGACTTCGCCGTCTAC
CGTGGGACCTTGCATACCCTTCACGACACCCTCCTCCGTGAGCTCTACGACCTGCTGGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCGGCCATCATGTTTCTTCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCTCCGAGC
CCCGCCGCGTATGTCGAATTCTCTGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAGTTTGGCCATGTTGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAATACCCCTGAAATCATGGGGGTCAACCCGTTGGGGATT
CTGGTGGCAGAAGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAGGCCATCCTCAGCGGCGCTGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTCGAGCTCTACAAGGAACTGGTCGAGATTCGGCGCGTCCAC
CAGCAATCTCTTCCAGAGGTCCCGTTCGCTGTCAACGTCGAGGATCTGCTGTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGGATACCGGAGTTTGTCGATCAGGCTATTAAGCAGGATCAGTTCCAGGTCCGCGCAGAG
GGTCCGGATCAGGCAGCCCGAGACTCGGAACGGCACAGCGTTTCCGTCATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGTCAGATCTTTGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTCTACTGCGACGCCGTCGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGATGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTTTATCCCGAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAG
GAGCTGGACAAGCTGGAGAAGAGCATGGACTCGGAGGCGTGCGCGCTGGTGCTCCAGCATATGGAGAGCCCCAGG
GCAAAGGCAAGGAAACCCAGCAAATACATCTTTACCATCAAGGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGAC
CCCAACGGCTACAGCGATCCCTACGTCGTCTTTGGCGACGAGTATCAAAAGCGCCTCCACAAGACGCGCGTCATT
CATCGAAGCCTCAACCCCCGTTGGGACGAGTCGTTTGAGATTACGGTGCAGGGTCCGATCAACGTCATTGCGACG
ATATGGGACCACGACACGTTTGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTT
GGCGACTACCTGCCCCGCGAGCTGTGGCTGGATCTAGATCTGCAGGGCCGCCTGCTGATGAGGGTCAGCATGGAA
GGGGAGCGAGACGACATCGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGAACGGAGAGGGACATGGTC
CGCAAGGTCACAGACAAGCTCATCACGCACATCACGGCGACGCTGTCTCCTGAGACGGTCCGGGGCGTGCTCGGC
CACGGTGGCGTTCTCGGCGCCTCAGTGACGAACCTGTGGAAGAAGCGAGCGGCCAAGACGCCGACGACGACGGTC
AGCCAGGTGGAAGGGGCGCTGGCGCCCTTGTTTACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTG
ACCGAGGCAACGATGACGGCCGTCATGACGCGGCTGTGGAAGGAGGTGCTGATGGCGATTGAGAATCTCCTCGTG
CCTCCCCTGTCGGAGAAGCCGTCGACGAAGAAGCCGCTGACGCGTCGGGAGCTGGACGTTGTATATCACTGGCTG
GAGATGCTCTTTACCTTTTTCAACGCCAGAGACGAGGACTCTGGCGAGCAGCTCGGGGTTCCGGGCGAGGTGCTC
AAGTCGCCTAAGTGGCACGAGCTGGCCTCGCTCAACTTCTTCTACCTCGAGGACACGAGCAGCCTGATTGGCGAG
TCGGAGCGAATGGCAACGGCAGCGGCCCTGAGGGCGCAGCAAGCGCTGCAGCAGAACCGCATGTCGGCTCCGGCG
GGCCTCGGGTCCGGGCTCGGCTCCCTGGCCGGCATGGGGACCATCAAGCGCGGCAAGAGCCTCAGGCGGAGCCGA
GCGACGACATGA
Transcript >Ophun1|3333
ATGTCGACAGCCTCGCGTCAGTCCCAGGGAGCCAACCTCTCCAACGCCTCGCGCAACTCTCGACCACCCAGTCGT
CGCCCTCGCCATGTCCCGTCCAGGACACGCTCCTCGATCCATCACCTGGCCGTCGAGCACGACGTCGCCCGCAGC
TTCGCCCTACGCACCGCCTATCTCCATCATCTCCTGCAGCCCCGGCCCAAGCGGAAGCAATACGTGGCTACGCCG
AAGCAACGATCCTATACCTCAGTCACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAGCTGCTCGACCGTGTTGGCGGCGTCGTCCGCGGCAGTGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCTCTCGTCCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGTCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTTCGCAACCATGGCCACGACCGCGACCGGCCGGACCTCATGTCGAGGCTGCTCACGCTCGAGAGCAAGATTCTC
ACAAACGACCAGAACCTATTCGAGACGGGCCCCGACGCTGCCGGCACCGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGCCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAGCGCTCCGTCTGGACAGAAGAGGCAGCTCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGCGCGCTGAGGAGTCAAGACTTTGACAGCGTCGACGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGAGATTCTGACTGTCAAGCCAGAGTTGGCCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCGAGTCGGCCCCAGTCGCTATACCTCGACGACACGGTCTGTGTGAGTCCAACCCGG
CCCGTGTCCATGTTTGGAGACGGCCTGGCTGGCTTCGACTCCCTGTCAATCGACTCGGACGCGAGTATAAACGAG
CCCATCTACACATTCATCCCTCCCAACCCCATCGCCTTCTATAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGTTGGCGACGGAGCTCTGT
GTGCGATGGCGCATTCCCCAGTCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCAACCCGTAAGTTTGTGGATCGC
GAGATTGTGCCTACCGAGCTGGATGCCATCTTCGACCTGGTCAAGTCACCTCTGTCAGAGGTTAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACCGACATCGACCCGAACAGGTGGACCGTCGACGACTTCGCCGTCTAC
CGTGGGACCTTGCATACCCTTCACGACACCCTCCTCCGTGAGCTCTACGACCTGCTGGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCGGCCATCATGTTTCTTCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCTCCGAGC
CCCGCCGCGTATGTCGAATTCTCTGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAGTTTGGCCATGTTGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAATACCCCTGAAATCATGGGGGTCAACCCGTTGGGGATT
CTGGTGGCAGAAGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAGGCCATCCTCAGCGGCGCTGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTCGAGCTCTACAAGGAACTGGTCGAGATTCGGCGCGTCCAC
CAGCAATCTCTTCCAGAGGTCCCGTTCGCTGTCAACGTCGAGGATCTGCTGTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGGATACCGGAGTTTGTCGATCAGGCTATTAAGCAGGATCAGTTCCAGGTCCGCGCAGAG
GGTCCGGATCAGGCAGCCCGAGACTCGGAACGGCACAGCGTTTCCGTCATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGTCAGATCTTTGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTCTACTGCGACGCCGTCGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGATGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTTTATCCCGAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAG
GAGCTGGACAAGCTGGAGAAGAGCATGGACTCGGAGGCGTGCGCGCTGGTGCTCCAGCATATGGAGAGCCCCAGG
GCAAAGGCAAGGAAACCCAGCAAATACATCTTTACCATCAAGGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGAC
CCCAACGGCTACAGCGATCCCTACGTCGTCTTTGGCGACGAGTATCAAAAGCGCCTCCACAAGACGCGCGTCATT
CATCGAAGCCTCAACCCCCGTTGGGACGAGTCGTTTGAGATTACGGTGCAGGGTCCGATCAACGTCATTGCGACG
ATATGGGACCACGACACGTTTGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTT
GGCGACTACCTGCCCCGCGAGCTGTGGCTGGATCTAGATCTGCAGGGCCGCCTGCTGATGAGGGTCAGCATGGAA
GGGGAGCGAGACGACATCGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGAACGGAGAGGGACATGGTC
CGCAAGGTCACAGACAAGCTCATCACGCACATCACGGCGACGCTGTCTCCTGAGACGGTCCGGGGCGTGCTCGGC
CACGGTGGCGTTCTCGGCGCCTCAGTGACGAACCTGTGGAAGAAGCGAGCGGCCAAGACGCCGACGACGACGGTC
AGCCAGGTGGAAGGGGCGCTGGCGCCCTTGTTTACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTG
ACCGAGGCAACGATGACGGCCGTCATGACGCGGCTGTGGAAGGAGGTGCTGATGGCGATTGAGAATCTCCTCGTG
CCTCCCCTGTCGGAGAAGCCGTCGACGAAGAAGCCGCTGACGCGTCGGGAGCTGGACGTTGTATATCACTGGCTG
GAGATGCTCTTTACCTTTTTCAACGCCAGAGACGAGGACTCTGGCGAGCAGCTCGGGGTTCCGGGCGAGGTGCTC
AAGTCGCCTAAGTGGCACGAGCTGGCCTCGCTCAACTTCTTCTACCTCGAGGACACGAGCAGCCTGATTGGCGAG
TCGGAGCGAATGGCAACGGCAGCGGCCCTGAGGGCGCAGCAAGCGCTGCAGCAGAACCGCATGTCGGCTCCGGCG
GGCCTCGGGTCCGGGCTCGGCTCCCTGGCCGGCATGGGGACCATCAAGCGCGGCAAGAGCCTCAGGCGGAGCCGA
GCGACGACATGA
Gene >Ophun1|3333
ATGTCGACAGCCTCGCGTCAGTCCCAGGGAGCCAACCTCTCCAACGCCTCGCGCAACTCTCGACCACCCAGTCGT
CGCCCTCGCCATGTCCCGTCCAGGACACGCTCCTCGATCCATCACCTGGCCGTCGAGCACGACGTCGCCCGCAGC
TTCGCCCTACGCACCGCCTATCTCCATCATCTCCTGCAGCCCCGGCCCAAGCGGAAGCAATACGTGGCTACGCCG
AAGCAACGATCCTATACCTCAGTCACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAGCTGCTCGACCGTGTTGGCGGCGTCGTCCGCGGCAGTGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCTCTCGTCCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGTCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTTCGCAACCATGGCCACGACCGCGACCGGCCGGACCTCATGTCGAGGCTGCTCACGCTCGAGAGCAAGATTCTC
ACAAACGACCAGAACCTATTCGAGACGGGCCCCGACGCTGCCGGCACCGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGCCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAGCGCTCCGTCTGGACAGAAGAGGCAGCTCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGCGCGCTGAGGAGTCAAGACTTTGACAGCGTCGACGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGAGATTCTGACTGTCAAGCCAGAGTTGGCCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCGAGTCGGCCCCAGTCGCTATACCTCGACGACACGGTCTGTGTGAGTCCAACCCGG
CCCGTGTCCATGTTTGGAGACGGCCTGGCTGGCTTCGACTCCCTGTCAATCGACTCGGACGCGAGTATAAACGAG
CCCATCTACACATTCATCCCTCCCAACCCCATCGCCTTCTATAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGTTGGCGACGGAGCTCTGT
GTGCGATGGCGCATTCCCCAGTCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCAACCCGTAAGTTTGTGGATCGC
GAGATTGTGCCTACCGAGCTGGATGCCATCTTCGACCTGGTCAAGTCACCTCTGTCAGAGGTTAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACCGACATCGACCCGAACAGGTGGACCGTCGACGACTTCGCCGTCTAC
CGTGGGACCTTGCATACCCTTCACGACACCCTCCTCCGTGAGCTCTACGACCTGCTGGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCGGCCATCATGTTTCTTCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCTCCGAGC
CCCGCCGCGTATGTCGAATTCTCTGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAGTTTGGCCATGTTGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAATACCCCTGAAATCATGGGGGTCAACCCGTTGGGGATT
CTGGTGGCAGAAGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAGGCCATCCTCAGCGGCGCTGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTCGAGCTCTACAAGGAACTGGTCGAGATTCGGCGCGTCCAC
CAGCAATCTCTTCCAGAGGTCCCGTTCGCTGTCAACGTCGAGGATCTGCTGTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGGATACCGGAGTTTGTCGATCAGGCTATTAAGCAGGATCAGTTCCAGGTCCGCGCAGAG
GGTCCGGATCAGGCAGCCCGAGACTCGGAACGGCACAGCGTTTCCGTCATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGTCAGATCTTTGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTCTACTGCGACGCCGTCGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGATGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTTTATCCCGAGGTGAGAGCTGTCCTTGTCTCTTGTTTCTCGGTTGTCGAT
GACTGACGTGTGATCACAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAGGAGCTGGACAAGCTGGA
GAAGAGCATGGACTCGGAGGCGTGCGCGCTGGTGCTCCAGCATATGGAGAGCCCCAGGGCAAAGGCAAGGAAACC
CAGCAAATACATCTTTACCATCAAGGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGACCCCAACGGCTACAGCGA
TCCCTACGTCGTCTTTGGCGACGAGTATCAAAAGCGCCTCCACAAGACGCGCGTCATTCATCGAAGCCTCAACCC
CCGTTGGGACGAGTCGTTTGAGATTACGGTGCAGGGTCCGATCAACGTCATTGCGACGATATGGGACCACGACAC
GTTTGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTTGGCGACTACCTGCCCCG
CGAGCTGTGGCTGGATCTAGATCTGCAGGGCCGCCTGCTGATGAGGGTCAGCATGGAAGGGGAGCGAGACGACAT
CGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGAACGGAGAGGGACATGGTCCGCAAGGTCACAGACAA
GGTATGAATGAGTGCGGCCCCTTGTTCTTTCTTGTCAGGAATGCTGACGCGGTATTGTGACAGCTCATCACGCAC
ATCACGGCGACGCTGTCTCCTGAGACGGTCCGGGGCGTGCTCGGCCACGGTGGCGTTCTCGGCGCCTCAGTGACG
AACCTGTGGAAGAAGCGAGCGGCCAAGACGCCGACGACGACGGTCAGCCAGGTGGAAGGGGCGCTGGCGCCCTTG
TTTACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTGACCGAGGCAACGATGACGGCCGTCATGACG
CGGCTGTGGAAGGAGGTGCTGATGGCGATTGAGAATCTCCTCGTGCCTCCCCTGTCGGAGAAGCCGTCGACGAAG
AAGCCGCTGACGCGTCGGGAGCTGGACGTTGTATATCACTGGCTGGAGATGCTCTTTACCTTTTTCAACGCCAGA
GACGAGGACTCTGGCGAGCAGCTCGGGGTTCCGGGCGAGGTGCTCAAGTCGCCTAAGTGGCACGAGCTGGCCTCG
CTCAACTTCTTCTACCTCGAGGACACGAGCAGCCTGATTGGCGAGTCGGAGCGAATGGCAACGGCAGCGGCCCTG
AGGGCGCAGCAAGCGCTGCAGCAGAACCGCATGTCGGCTCCGGCGGGCCTCGGGTCCGGGCTCGGCTCCCTGGCC
GGCATGGGGACCATCAAGCGCGGCAAGAGCGTCATGATGAGCCGAAACCTGGGCACGATGCGCAAGGCCAAGGAG
GCCAGGCGGCGGGAAGCTCAGGCGGAGCCGAGCGACGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail