Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3327
Gene name
LocationContig_297:19083..21042
Strand-
Gene length (bp)1959
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase 9.8E-202 31 586

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00614|CACP_CANTR Carnitine O-acetyltransferase, mitochondrial OS=Candida tropicalis GN=CAT2 PE=3 SV=1 17 599 4.0E-174
sp|P32796|CACP_YEAST Carnitine O-acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT2 PE=1 SV=2 18 592 7.0E-142
sp|P43155|CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens GN=CRAT PE=1 SV=5 25 607 2.0E-121
sp|Q704S8|CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus GN=Crat PE=1 SV=1 3 607 4.0E-119
sp|P52826|CACP_COLLI Carnitine O-acetyltransferase OS=Columba livia GN=CRAT PE=1 SV=1 2 607 6.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00614|CACP_CANTR Carnitine O-acetyltransferase, mitochondrial OS=Candida tropicalis GN=CAT2 PE=3 SV=1 17 599 4.0E-174
sp|P32796|CACP_YEAST Carnitine O-acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT2 PE=1 SV=2 18 592 7.0E-142
sp|P43155|CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens GN=CRAT PE=1 SV=5 25 607 2.0E-121
sp|Q704S8|CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus GN=Crat PE=1 SV=1 3 607 4.0E-119
sp|P52826|CACP_COLLI Carnitine O-acetyltransferase OS=Columba livia GN=CRAT PE=1 SV=1 2 607 6.0E-118
sp|P47934|CACP_MOUSE Carnitine O-acetyltransferase OS=Mus musculus GN=Crat PE=1 SV=3 3 607 1.0E-117
sp|P13222|CLAT_PIG Choline O-acetyltransferase OS=Sus scrofa GN=CHAT PE=1 SV=3 28 605 5.0E-100
sp|B2ZGJ1|CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio GN=chat PE=2 SV=1 27 573 3.0E-98
sp|Q03059|CLAT_MOUSE Choline O-acetyltransferase OS=Mus musculus GN=Chat PE=2 SV=2 28 603 3.0E-98
sp|P28329|CLAT_HUMAN Choline O-acetyltransferase OS=Homo sapiens GN=CHAT PE=1 SV=4 25 595 4.0E-98
sp|P32738|CLAT_RAT Choline O-acetyltransferase OS=Rattus norvegicus GN=Chat PE=1 SV=2 28 603 3.0E-94
sp|Q90YJ9|CLAT_CHICK Choline O-acetyltransferase OS=Gallus gallus GN=CHAT PE=2 SV=1 13 601 3.0E-88
sp|P52825|CPT2_MOUSE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus GN=Cpt2 PE=1 SV=2 2 592 3.0E-78
sp|Q60HG9|CPT2_MACFA Carnitine O-palmitoyltransferase 2, mitochondrial OS=Macaca fascicularis GN=CPT2 PE=2 SV=1 2 592 5.0E-78
sp|P23786|CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens GN=CPT2 PE=1 SV=2 2 592 8.0E-78
sp|P07668|CLAT_DROME Choline O-acetyltransferase OS=Drosophila melanogaster GN=Cha PE=1 SV=3 24 598 2.0E-76
sp|O19094|OCTC_BOVIN Peroxisomal carnitine O-octanoyltransferase OS=Bos taurus GN=CROT PE=1 SV=1 22 565 4.0E-74
sp|Q68Y62|CPT1A_HORSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Equus caballus GN=CPT1A PE=2 SV=1 18 596 9.0E-74
sp|P18886|CPT2_RAT Carnitine O-palmitoyltransferase 2, mitochondrial OS=Rattus norvegicus GN=Cpt2 PE=1 SV=1 2 592 1.0E-73
sp|P50416|CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens GN=CPT1A PE=1 SV=2 1 604 5.0E-73
sp|Q2KJB7|CPT2_BOVIN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Bos taurus GN=CPT2 PE=2 SV=1 3 592 4.0E-72
sp|Q6P4X5|CPT2_XENTR Carnitine O-palmitoyltransferase 2, mitochondrial OS=Xenopus tropicalis GN=cpt2 PE=2 SV=1 22 573 5.0E-72
sp|P97742|CPT1A_MOUSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus GN=Cpt1a PE=1 SV=4 18 596 3.0E-71
sp|P32198|CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus GN=Cpt1a PE=1 SV=2 18 596 9.0E-71
sp|Q5U3U3|CPT2_DANRE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Danio rerio GN=cpt2 PE=2 SV=2 22 573 2.0E-70
sp|Q8HY46|CPT1B_PIG Carnitine O-palmitoyltransferase 1, muscle isoform OS=Sus scrofa GN=CPT1B PE=2 SV=1 2 597 4.0E-70
sp|Q92523|CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens GN=CPT1B PE=1 SV=2 16 597 1.0E-69
sp|Q58DK1|CPT1B_BOVIN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Bos taurus GN=CPT1B PE=2 SV=1 24 597 2.0E-69
sp|Q924X2|CPT1B_MOUSE Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus GN=Cpt1b PE=1 SV=1 24 596 4.0E-69
sp|Q7ZXE1|CPT2_XENLA Carnitine O-palmitoyltransferase 2, mitochondrial OS=Xenopus laevis GN=cpt2 PE=2 SV=1 22 573 5.0E-69
sp|Q9UKG9|OCTC_HUMAN Peroxisomal carnitine O-octanoyltransferase OS=Homo sapiens GN=CROT PE=1 SV=2 22 565 2.0E-68
sp|P11466|OCTC_RAT Peroxisomal carnitine O-octanoyltransferase OS=Rattus norvegicus GN=Crot PE=1 SV=3 6 565 2.0E-68
sp|Q63704|CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus GN=Cpt1b PE=1 SV=1 24 596 4.0E-68
sp|Q9DC50|OCTC_MOUSE Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus GN=Crot PE=1 SV=1 22 565 6.0E-68
sp|F1LN46|CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus GN=Cpt1c PE=1 SV=1 21 599 2.0E-66
sp|Q8BGD5|CPT1C_MOUSE Carnitine O-palmitoyltransferase 1, brain isoform OS=Mus musculus GN=Cpt1c PE=1 SV=1 21 599 5.0E-66
sp|Q8TCG5|CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens GN=CPT1C PE=1 SV=1 1 599 8.0E-65
sp|P80235|CACM_YEAST Putative mitochondrial carnitine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAT1 PE=1 SV=2 27 606 1.0E-63
sp|P32756|CLAT_CAEEL Choline O-acetyltransferase OS=Caenorhabditis elegans GN=cha-1 PE=2 SV=1 24 569 8.0E-53
sp|P75448|Y114_MYCPN Putative acetyltransferase MPN_114 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_114 PE=3 SV=1 25 567 5.0E-41
sp|P40017|YAT2_YEAST Carnitine O-acetyltransferase YAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAT2 PE=1 SV=1 12 581 9.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3327
MSRPSSSLAPGIVEDTSKGSMLRFQDSLPRLPVPSLQETASRYLKSLHPLLSRAEYEVSQQAVTDFIKPGGIGTK
LQERLMARREDPALKNWLYDWWNQAAYLAYRDPVVPYVSYFYSHRDDRQRRDPAKRAAALTSAVLEFKGLVDNGK
IEPEYMKNSPLCMDSYQWMFNCCRIAAKPSDYPLKFDPTKNKHIIAIRKNQFFKIPHEVGNRPLNSSELEMQFRR
VYEVAQRGPAVGILTSENRDIWADARDCLLQAGRLNKDVLEAIESSSFVVCLDDASPVTLEERAHQYWHGDGANR
WFDKPLQFIINDNGTSGFMGEHSMMDGTPTHRLNDFVNRTTLANKMDLADTSIRSDLSDPQLLQFEITPEVQRAI
DRATKDFHHAIGQHQLAVQAYQGYGKNLIKQFKCSPDAYVQMMIQLAYFKMFGKNRPTYESASTRRFQLGRTETC
RSVSDESVAFCTAVCDPSVDDVQTKIALLRKAIDAHIEYVSAASNGKGVDRHLLGLKKLLQPGEELPSIYSDPAY
AYSSSWYLSTSQLSSEHFNGYGWSQVIDGGFGIAYMINENSINFNIVSKHLGSDRMSHYINEAAEDMRGLFHSGS
SQPRAKL*
Coding >Ophun1|3327
ATGAGTCGTCCGAGCAGCTCCCTGGCTCCTGGAATTGTCGAGGACACTTCCAAGGGCTCGATGTTAAGATTCCAA
GACTCCCTGCCACGGTTACCGGTCCCTAGTCTCCAAGAAACAGCCAGTAGATACCTCAAGTCTCTACACCCCTTA
CTTTCCCGGGCCGAGTACGAGGTCAGTCAGCAGGCCGTCACTGATTTCATCAAGCCTGGGGGTATCGGAACCAAA
TTACAGGAACGGCTCATGGCCAGAAGGGAGGACCCTGCCCTCAAGAACTGGCTCTACGATTGGTGGAACCAGGCG
GCGTATCTAGCATATCGCGATCCTGTTGTGCCCTACGTCAGCTACTTTTATTCACATCGGGATGATCGTCAACGT
CGCGACCCCGCCAAGCGGGCAGCAGCTCTAACATCTGCCGTTCTGGAGTTCAAGGGACTTGTCGACAACGGCAAA
ATTGAGCCCGAGTACATGAAGAACTCGCCTCTCTGCATGGATAGTTACCAATGGATGTTCAACTGCTGCCGCATC
GCTGCCAAGCCGTCAGACTATCCTCTTAAGTTCGACCCAACCAAGAATAAGCACATCATTGCCATCCGGAAAAAC
CAATTCTTCAAGATACCACATGAAGTCGGAAACAGGCCACTCAACTCTTCGGAACTCGAGATGCAGTTCAGACGT
GTTTACGAGGTTGCGCAGCGTGGCCCAGCTGTTGGAATCTTGACTTCAGAGAACCGCGACATTTGGGCTGACGCT
CGTGATTGTCTCCTTCAAGCTGGCCGCCTGAACAAGGACGTCCTGGAGGCCATCGAGTCTTCATCCTTCGTTGTC
TGCCTCGATGACGCATCTCCAGTCACACTTGAAGAACGCGCCCATCAGTACTGGCACGGTGATGGAGCCAACCGC
TGGTTTGACAAGCCGCTGCAATTCATCATCAATGACAATGGCACCTCGGGCTTCATGGGCGAACACTCCATGATG
GACGGAACCCCCACTCACCGCCTGAATGACTTCGTGAACCGTACGACACTTGCCAACAAAATGGACCTCGCAGAC
ACGTCAATACGTTCCGACCTCAGTGATCCCCAGCTATTGCAGTTTGAGATCACTCCCGAGGTTCAGAGGGCGATA
GACCGCGCCACAAAAGATTTTCACCACGCCATCGGCCAGCATCAACTCGCCGTCCAGGCTTATCAGGGCTATGGA
AAGAACCTGATCAAGCAATTCAAGTGTTCACCCGACGCATACGTGCAGATGATGATACAGCTTGCCTACTTCAAG
ATGTTCGGCAAAAATCGTCCGACCTACGAGTCGGCTTCAACTCGTCGCTTCCAACTCGGTCGCACGGAGACATGC
AGGTCCGTTTCAGACGAGTCGGTTGCTTTTTGCACCGCAGTTTGCGATCCATCGGTAGATGATGTCCAAACGAAG
ATTGCTCTCCTACGGAAAGCCATTGACGCTCACATCGAGTACGTGTCTGCGGCGTCGAATGGCAAAGGAGTCGAT
AGGCATCTGCTTGGCCTGAAGAAGCTCCTGCAACCCGGCGAGGAGCTTCCGAGTATCTACAGTGACCCAGCCTAC
GCCTACTCCAGCTCGTGGTATTTGTCAACGTCTCAGCTGAGCTCGGAACATTTCAATGGGTACGGTTGGAGCCAG
GTCATTGACGGCGGTTTCGGCATCGCGTACATGATCAACGAGAACAGCATTAACTTCAACATTGTTTCGAAACAC
CTTGGAAGCGATCGAATGAGTCACTATATCAACGAAGCCGCCGAGGATATGCGTGGCTTGTTCCACTCTGGTTCG
TCGCAACCCAGAGCAAAGCTGTGA
Transcript >Ophun1|3327
ATGAGTCGTCCGAGCAGCTCCCTGGCTCCTGGAATTGTCGAGGACACTTCCAAGGGCTCGATGTTAAGATTCCAA
GACTCCCTGCCACGGTTACCGGTCCCTAGTCTCCAAGAAACAGCCAGTAGATACCTCAAGTCTCTACACCCCTTA
CTTTCCCGGGCCGAGTACGAGGTCAGTCAGCAGGCCGTCACTGATTTCATCAAGCCTGGGGGTATCGGAACCAAA
TTACAGGAACGGCTCATGGCCAGAAGGGAGGACCCTGCCCTCAAGAACTGGCTCTACGATTGGTGGAACCAGGCG
GCGTATCTAGCATATCGCGATCCTGTTGTGCCCTACGTCAGCTACTTTTATTCACATCGGGATGATCGTCAACGT
CGCGACCCCGCCAAGCGGGCAGCAGCTCTAACATCTGCCGTTCTGGAGTTCAAGGGACTTGTCGACAACGGCAAA
ATTGAGCCCGAGTACATGAAGAACTCGCCTCTCTGCATGGATAGTTACCAATGGATGTTCAACTGCTGCCGCATC
GCTGCCAAGCCGTCAGACTATCCTCTTAAGTTCGACCCAACCAAGAATAAGCACATCATTGCCATCCGGAAAAAC
CAATTCTTCAAGATACCACATGAAGTCGGAAACAGGCCACTCAACTCTTCGGAACTCGAGATGCAGTTCAGACGT
GTTTACGAGGTTGCGCAGCGTGGCCCAGCTGTTGGAATCTTGACTTCAGAGAACCGCGACATTTGGGCTGACGCT
CGTGATTGTCTCCTTCAAGCTGGCCGCCTGAACAAGGACGTCCTGGAGGCCATCGAGTCTTCATCCTTCGTTGTC
TGCCTCGATGACGCATCTCCAGTCACACTTGAAGAACGCGCCCATCAGTACTGGCACGGTGATGGAGCCAACCGC
TGGTTTGACAAGCCGCTGCAATTCATCATCAATGACAATGGCACCTCGGGCTTCATGGGCGAACACTCCATGATG
GACGGAACCCCCACTCACCGCCTGAATGACTTCGTGAACCGTACGACACTTGCCAACAAAATGGACCTCGCAGAC
ACGTCAATACGTTCCGACCTCAGTGATCCCCAGCTATTGCAGTTTGAGATCACTCCCGAGGTTCAGAGGGCGATA
GACCGCGCCACAAAAGATTTTCACCACGCCATCGGCCAGCATCAACTCGCCGTCCAGGCTTATCAGGGCTATGGA
AAGAACCTGATCAAGCAATTCAAGTGTTCACCCGACGCATACGTGCAGATGATGATACAGCTTGCCTACTTCAAG
ATGTTCGGCAAAAATCGTCCGACCTACGAGTCGGCTTCAACTCGTCGCTTCCAACTCGGTCGCACGGAGACATGC
AGGTCCGTTTCAGACGAGTCGGTTGCTTTTTGCACCGCAGTTTGCGATCCATCGGTAGATGATGTCCAAACGAAG
ATTGCTCTCCTACGGAAAGCCATTGACGCTCACATCGAGTACGTGTCTGCGGCGTCGAATGGCAAAGGAGTCGAT
AGGCATCTGCTTGGCCTGAAGAAGCTCCTGCAACCCGGCGAGGAGCTTCCGAGTATCTACAGTGACCCAGCCTAC
GCCTACTCCAGCTCGTGGTATTTGTCAACGTCTCAGCTGAGCTCGGAACATTTCAATGGGTACGGTTGGAGCCAG
GTCATTGACGGCGGTTTCGGCATCGCGTACATGATCAACGAGAACAGCATTAACTTCAACATTGTTTCGAAACAC
CTTGGAAGCGATCGAATGAGTCACTATATCAACGAAGCCGCCGAGGATATGCGTGGCTTGTTCCACTCTGGTTCG
TCGCAACCCAGAGCAAAGCTGTGA
Gene >Ophun1|3327
ATGAGTCGTCCGAGCAGCTCCCTGGCTCCTGGTACGTGCTGAGCGGCCCCGATTGTCCCTTCATCGAGCTGAGCC
GTGTTGACGTGGCGAATGTCGCGAGCAGGAATTGTCGAGGACACTTCCAAGGGCTCGATGTTAAGATTCCAAGAC
TCCCTGCCACGGTTACCGGTCCCTAGTCTCCAAGAAACAGCCAGTAGATACCTCAAGTCTCTACACCCCTTACTT
TCCCGGGCCGAGTACGAGGTCAGTCAGCAGGCCGTCACTGATTTCATCAAGCCTGGGGGTATCGGAACCAAATTA
CAGGAACGGCTCATGGCCAGAAGGGAGGACCCTGCCCTCAAGAACTGGCTCTACGATTGGTGGAACCAGGCGGCG
TATCTAGCATATCGCGATCCTGTTGTGCCCTACGTCAGCTACTTTTATTCACATCGGGATGATCGTCAACGTCGC
GACCCCGCCAAGCGGGCAGCAGCTCTAACATCTGCCGTTCTGGAGTTCAAGGGACTTGTCGACAACGGCAAAATT
GAGCCCGAGTACATGAAGAACTCGCCTCTCTGCATGGATAGTTACCAATGGATGTTCAACTGCTGCCGCATCGCT
GCCAAGCCGTCAGACTATCCTCTTAAGTTCGACCCAACCAAGAATAAGCACATCATTGCCATCCGGAAAAACCAA
TTCTTCAAGATACCACATGAAGTCGGAAACAGGCCACTCAACTCTTCGGAACTCGAGATGCAGTTCAGACGTGTT
TACGAGGTTGCGCAGCGTGGCCCAGCTGTTGGAATCTTGACTTCAGAGAACCGCGACATTTGGGCTGACGCTCGT
GATTGTCTCCTTCAAGCTGGCCGCCTGAACAAGGACGTCCTGGAGGCCATCGAGTCTTCATCCTTCGTTGTCTGC
CTCGATGACGCATCTCCAGTCACACTTGAAGAACGCGCCCATCAGTACTGGCACGGTGATGGAGCCAACCGCTGG
TTTGACAAGCCGCTGCAATTCATCATCAATGACAATGGCACCTCGGGCTTCATGGGCGAACACTCCATGATGGAC
GGAACCCCCACTCACCGCCTGAATGACTTCGTGAACCGTACGACACTTGCCAACAAAATGGACCTCGCAGACACG
TCAATACGTTCCGACCTCAGTGATCCCCAGCTATTGCAGTTTGAGATCACTCCCGAGGTTCAGAGGGCGATAGAC
CGCGCCACAAAAGATTTTCACCACGCCATCGGCCAGCATCAACTCGCCGTCCAGGCTTATCAGGGCTATGGAAAG
AACCTGATCAAGCAATTCAAGTGTTCACCCGACGCATACGTGCAGATGATGATACAGCTTGCCTACTTCAAGATG
TTCGGCAAAAATCGTCCGACCTACGAGTCGGCTTCAACTCGTCGCTTCCAACTCGGTCGCACGGAGACATGCAGG
TCCGTTTCAGACGAGTCGGTTGCTTTTTGCACCGCAGTTTGCGATCCATCGGTAGATGATGTCCAAACGAAGATT
GCTCTCCTACGGAAAGCCATTGACGCTCACATCGAGTACGTGTCTGCGGCGTCGAATGGCAAAGGAGTCGATAGG
CATCTGCTTGGCCTGAAGAAGCTCCTGCAACCCGGCGAGGAGCTTCCGAGTATCTACAGTGACCCAGCCTACGCC
TACTCCAGCTCGTGGTATTTGTCAACGTCTCAGCTGAGCTCGGAACATTTCAATGGGTACGGTTGGAGCCAGGTC
ATTGACGGCGGTTTCGGCATCGCGTACATGATCAACGAGAACAGGTGAGTCACCCTTGCGAAAGATTACAAAGTC
GCCAGGTGCAGAGTTGCTTACGTCTTAAACAGCATTAACTTCAACATTGTTTCGAAACACCTTGGAAGCGATCGA
ATGAGTCACTATATCAACGAAGCCGCCGAGGATATGCGTGGCTTGTTCCACTCTGGTTCGTCGCAACCCAGAGCA
AAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail