Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3324
Gene name
LocationContig_297:13223..14349
Strand+
Gene length (bp)1126
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01012 ETF Electron transfer flavoprotein domain 7.0E-43 40 205
PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain 5.3E-33 229 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78790|ETFA_SCHPO Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27D7.06 PE=2 SV=3 34 349 1.0E-118
sp|P0CN60|ETFA_CRYNJ Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ETF1 PE=3 SV=1 13 349 6.0E-113
sp|P0CN61|ETFA_CRYNB Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ETF1 PE=3 SV=1 13 349 6.0E-113
sp|Q5Y223|ETFA_CRYGW Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=ETF1 PE=3 SV=1 13 349 4.0E-110
sp|Q2KJE4|ETFA_BOVIN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Bos taurus GN=ETFA PE=2 SV=1 20 350 6.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78790|ETFA_SCHPO Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27D7.06 PE=2 SV=3 34 349 1.0E-118
sp|P0CN60|ETFA_CRYNJ Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ETF1 PE=3 SV=1 13 349 6.0E-113
sp|P0CN61|ETFA_CRYNB Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ETF1 PE=3 SV=1 13 349 6.0E-113
sp|Q5Y223|ETFA_CRYGW Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=ETF1 PE=3 SV=1 13 349 4.0E-110
sp|Q2KJE4|ETFA_BOVIN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Bos taurus GN=ETFA PE=2 SV=1 20 350 6.0E-110
sp|Q5RC31|ETFA_PONAB Electron transfer flavoprotein subunit alpha, mitochondrial OS=Pongo abelii GN=ETFA PE=2 SV=1 20 350 1.0E-109
sp|Q8HXY0|ETFA_MACFA Electron transfer flavoprotein subunit alpha, mitochondrial OS=Macaca fascicularis GN=ETFA PE=2 SV=1 20 350 1.0E-109
sp|P13804|ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens GN=ETFA PE=1 SV=1 20 350 1.0E-109
sp|Q99LC5|ETFA_MOUSE Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus GN=Etfa PE=1 SV=2 20 350 2.0E-109
sp|Q8J112|ETFA_CRYNV Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Cryptococcus neoformans var. grubii GN=ETF1 PE=3 SV=1 32 349 2.0E-108
sp|P13803|ETFA_RAT Electron transfer flavoprotein subunit alpha, mitochondrial OS=Rattus norvegicus GN=Etfa PE=1 SV=4 20 350 2.0E-108
sp|Q9HZP7|ETFA_PSEAE Electron transfer flavoprotein subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=etfA PE=3 SV=1 38 349 4.0E-101
sp|Q54FD7|ETFA_DICDI Electron transfer flavoprotein subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=etfa PE=3 SV=1 40 352 2.0E-100
sp|Q93615|ETFA_CAEEL Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=F27D4.1 PE=3 SV=2 31 346 2.0E-100
sp|Q12480|ETFA_YEAST Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM45 PE=1 SV=1 34 349 6.0E-97
sp|Q9C6I6|ETFA_ARATH Electron transfer flavoprotein subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=ETFA PE=1 SV=1 36 349 4.0E-90
sp|P38974|ETFA_PARDE Electron transfer flavoprotein subunit alpha OS=Paracoccus denitrificans GN=etfA PE=1 SV=2 91 349 2.0E-88
sp|P53573|ETFA_BRADU Electron transfer flavoprotein subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=etfA PE=3 SV=2 91 346 5.0E-84
sp|A2XNR6|ETFA_ORYSI Electron transfer flavoprotein subunit alpha, mitochondrial OS=Oryza sativa subsp. indica GN=ETFA PE=3 SV=1 81 349 4.0E-81
sp|Q75LJ3|ETFA_ORYSJ Electron transfer flavoprotein subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=ETFA PE=3 SV=1 81 349 4.0E-81
sp|P94551|ETFA_BACSU Electron transfer flavoprotein subunit alpha OS=Bacillus subtilis (strain 168) GN=etfA PE=3 SV=1 45 350 2.0E-63
sp|P9WNG9|ETFA_MYCTU Electron transfer flavoprotein subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=etfA PE=1 SV=1 41 350 1.0E-59
sp|P9WNG8|ETFA_MYCTO Electron transfer flavoprotein subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=etfA PE=3 SV=1 41 350 1.0E-59
sp|O33096|ETFA_MYCLE Electron transfer flavoprotein subunit alpha OS=Mycobacterium leprae (strain TN) GN=etfA PE=3 SV=1 41 350 1.0E-53
sp|P52039|ETFA_CLOAB Electron transfer flavoprotein subunit alpha OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=etfA PE=3 SV=2 45 352 2.0E-50
sp|P53578|FIXB_CLOSA Protein FixB OS=Clostridium saccharobutylicum GN=fixB PE=3 SV=1 45 350 3.0E-50
sp|O85692|ETFA_MEGEL Electron transfer flavoprotein subunit alpha OS=Megasphaera elsdenii GN=etfA PE=3 SV=1 43 350 8.0E-47
sp|P71153|ETFA_THETC Electron transfer flavoprotein subunit alpha OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=etfA PE=3 SV=2 45 350 1.0E-46
sp|G3KIM6|ETFA_CLOPR Acryloyl-CoA reductase electron transfer subunit beta OS=Clostridium propionicum GN=acrA PE=1 SV=1 44 350 3.0E-35
sp|P53574|FIXB_AZOVI Protein FixB OS=Azotobacter vinelandii GN=fixB PE=3 SV=1 43 350 2.0E-33
sp|P26483|FIXB_AZOC5 Protein FixB OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixB PE=3 SV=2 44 350 8.0E-30
sp|P10449|FIXB_BRADU Protein FixB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixB PE=3 SV=2 44 346 4.0E-29
sp|B7L4G5|FIXB_ECO55 Protein FixB OS=Escherichia coli (strain 55989 / EAEC) GN=fixB PE=3 SV=1 89 346 2.0E-26
sp|P64096|FIXB_SALTI Protein FixB OS=Salmonella typhi GN=fixB PE=3 SV=1 59 346 2.0E-26
sp|B5F757|FIXB_SALA4 Protein FixB OS=Salmonella agona (strain SL483) GN=fixB PE=3 SV=1 59 346 2.0E-26
sp|B5BL14|FIXB_SALPK Protein FixB OS=Salmonella paratyphi A (strain AKU_12601) GN=fixB PE=3 SV=1 59 346 2.0E-26
sp|P64095|FIXB_SALTY Protein FixB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fixB PE=3 SV=1 59 346 2.0E-26
sp|Q5PIP0|FIXB_SALPA Protein FixB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fixB PE=3 SV=1 59 346 2.0E-26
sp|B6HYZ3|FIXB_ECOSE Protein FixB OS=Escherichia coli (strain SE11) GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|A7ZVZ4|FIXB_ECOHS Protein FixB OS=Escherichia coli O9:H4 (strain HS) GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|B7M0D9|FIXB_ECO8A Protein FixB OS=Escherichia coli O8 (strain IAI1) GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|Q1RGF6|FIXB_ECOUT Protein FixB OS=Escherichia coli (strain UTI89 / UPEC) GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|A1A792|FIXB_ECOK1 Protein FixB OS=Escherichia coli O1:K1 / APEC GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|B7MAG5|FIXB_ECO45 Protein FixB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fixB PE=3 SV=1 89 346 4.0E-26
sp|B5YYD6|FIXB_ECO5E Protein FixB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fixB PE=3 SV=1 108 346 6.0E-26
sp|Q32K55|FIXB_SHIDS Protein FixB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fixB PE=3 SV=1 108 346 6.0E-26
sp|Q8XA27|FIXB_ECO57 Protein FixB OS=Escherichia coli O157:H7 GN=fixB PE=3 SV=1 108 346 6.0E-26
sp|B1LFX6|FIXB_ECOSM Protein FixB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fixB PE=3 SV=1 89 346 8.0E-26
sp|B7NHE6|FIXB_ECO7I Protein FixB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fixB PE=3 SV=1 89 346 1.0E-25
sp|B7UI88|FIXB_ECO27 Protein FixB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|P59674|FIXB_ECOL6 Protein FixB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|B1IRD4|FIXB_ECOLC Protein FixB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|C4ZPW8|FIXB_ECOBW Protein FixB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|B1XBG7|FIXB_ECODH Protein FixB OS=Escherichia coli (strain K12 / DH10B) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|P31574|FIXB_ECOLI Protein FixB OS=Escherichia coli (strain K12) GN=fixB PE=1 SV=3 108 346 1.0E-25
sp|Q3Z5W6|FIXB_SHISS Protein FixB OS=Shigella sonnei (strain Ss046) GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|P59675|FIXB_SHIFL Protein FixB OS=Shigella flexneri GN=fixB PE=3 SV=1 108 346 1.0E-25
sp|B7MNP9|FIXB_ECO81 Protein FixB OS=Escherichia coli O81 (strain ED1a) GN=fixB PE=3 SV=1 89 346 2.0E-25
sp|P77378|YDIR_ECOLI Putative electron transfer flavoprotein subunit YdiR OS=Escherichia coli (strain K12) GN=ydiR PE=3 SV=1 108 349 3.0E-25
sp|Q0TLU7|FIXB_ECOL5 Protein FixB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fixB PE=3 SV=1 108 346 3.0E-25
sp|B7LWN3|FIXB_ESCF3 Protein FixB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fixB PE=3 SV=1 108 346 3.0E-25
sp|B7N7R7|FIXB_ECOLU Protein FixB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fixB PE=3 SV=1 108 346 4.0E-25
sp|A7ZHD5|FIXB_ECO24 Protein FixB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fixB PE=3 SV=1 108 345 7.0E-25
sp|P09819|FIXB_RHIME Protein FixB OS=Rhizobium meliloti (strain 1021) GN=fixB PE=3 SV=1 44 347 1.0E-24
sp|Q53209|FIXB_RHISN Protein FixB OS=Rhizobium sp. (strain NGR234) GN=fixB PE=3 SV=1 44 347 3.0E-24
sp|Q46907|YGCQ_ECOLI Putative electron transfer flavoprotein subunit YgcQ OS=Escherichia coli (strain K12) GN=ygcQ PE=3 SV=2 132 349 6.0E-22
sp|P53571|ETFA_METME Electron transfer flavoprotein subunit alpha OS=Methylophilus methylotrophus GN=etfA PE=1 SV=2 41 345 1.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3324
MSAKIISISGVGRHLFRTNRSLRPGPLALSISSKRRLLATLAVLEQRDGKLHEASLRTLTAAKNLGGSVHAFLAG
SSVSAAAEDAAKVDGVEQVTVVENAAYEKALPENYAQLLAENVKKGGYTHIVAGHSSFGKNTLPRVAALLDSQQI
SDITSIENETTFVRPIYAGNAISTVESSDQVKVITIRGTAFEAPAIGSKSATVTTGVDPQAESPTEWISEDLAKS
DRPELAQASKVISGGRGLKSKEDFDRLILPLADALGAAVGASRAAVDSGYADNALQVGQTGKVVAPQLYLAVGIS
GAIQHLAGMKDSKTIAAINKDADAPIFQVADVGLVGDLFEIVPKLTDKVKGS*
Coding >Ophun1|3324
ATGTCCGCCAAGATCATCAGCATTTCTGGTGTAGGAAGGCATCTGTTCAGGACAAACCGGAGTCTTCGTCCTGGC
CCATTGGCCTTGTCCATATCGTCCAAGAGAAGACTCCTGGCGACACTGGCAGTGCTTGAACAACGGGACGGCAAA
CTACATGAGGCTTCGCTTCGGACCCTGACAGCAGCTAAAAACTTGGGCGGGAGTGTTCATGCGTTCTTAGCCGGG
AGCAGTGTTTCCGCCGCAGCCGAGGATGCAGCCAAAGTTGACGGCGTGGAGCAAGTCACTGTTGTCGAGAACGCT
GCATATGAGAAGGCACTCCCTGAAAACTACGCTCAATTACTGGCCGAAAACGTCAAAAAGGGAGGCTATACACAC
ATCGTCGCCGGTCACTCGTCATTCGGGAAGAACACGCTACCCAGAGTCGCGGCTCTGCTCGATTCGCAGCAAATA
TCCGACATAACGTCAATTGAAAACGAGACAACGTTCGTCCGGCCTATTTATGCGGGAAATGCCATTTCGACAGTT
GAGTCTTCAGACCAAGTCAAAGTTATTACAATTCGGGGAACTGCCTTTGAAGCTCCTGCAATAGGGTCAAAGTCA
GCCACCGTGACAACTGGCGTGGATCCCCAGGCAGAGTCGCCTACTGAATGGATTTCGGAGGATCTTGCCAAATCA
GACCGTCCCGAGCTGGCCCAGGCTAGCAAAGTTATTTCAGGTGGCCGCGGACTCAAGTCCAAGGAAGACTTTGAC
AGGCTGATACTGCCCCTCGCCGATGCTCTGGGTGCGGCTGTTGGGGCATCGCGGGCTGCCGTTGACAGCGGCTAC
GCGGATAATGCCCTCCAGGTGGGACAGACCGGCAAGGTCGTTGCTCCCCAGCTCTACTTAGCTGTTGGCATCTCG
GGTGCAATTCAGCACTTAGCTGGCATGAAAGACAGCAAGACAATTGCAGCCATCAACAAGGATGCTGATGCCCCT
ATCTTCCAGGTAGCGGACGTCGGGCTGGTAGGGGATCTTTTCGAGATAGTGCCCAAGTTGACAGACAAAGTGAAA
GGCTCTTGA
Transcript >Ophun1|3324
ATGTCCGCCAAGATCATCAGCATTTCTGGTGTAGGAAGGCATCTGTTCAGGACAAACCGGAGTCTTCGTCCTGGC
CCATTGGCCTTGTCCATATCGTCCAAGAGAAGACTCCTGGCGACACTGGCAGTGCTTGAACAACGGGACGGCAAA
CTACATGAGGCTTCGCTTCGGACCCTGACAGCAGCTAAAAACTTGGGCGGGAGTGTTCATGCGTTCTTAGCCGGG
AGCAGTGTTTCCGCCGCAGCCGAGGATGCAGCCAAAGTTGACGGCGTGGAGCAAGTCACTGTTGTCGAGAACGCT
GCATATGAGAAGGCACTCCCTGAAAACTACGCTCAATTACTGGCCGAAAACGTCAAAAAGGGAGGCTATACACAC
ATCGTCGCCGGTCACTCGTCATTCGGGAAGAACACGCTACCCAGAGTCGCGGCTCTGCTCGATTCGCAGCAAATA
TCCGACATAACGTCAATTGAAAACGAGACAACGTTCGTCCGGCCTATTTATGCGGGAAATGCCATTTCGACAGTT
GAGTCTTCAGACCAAGTCAAAGTTATTACAATTCGGGGAACTGCCTTTGAAGCTCCTGCAATAGGGTCAAAGTCA
GCCACCGTGACAACTGGCGTGGATCCCCAGGCAGAGTCGCCTACTGAATGGATTTCGGAGGATCTTGCCAAATCA
GACCGTCCCGAGCTGGCCCAGGCTAGCAAAGTTATTTCAGGTGGCCGCGGACTCAAGTCCAAGGAAGACTTTGAC
AGGCTGATACTGCCCCTCGCCGATGCTCTGGGTGCGGCTGTTGGGGCATCGCGGGCTGCCGTTGACAGCGGCTAC
GCGGATAATGCCCTCCAGGTGGGACAGACCGGCAAGGTCGTTGCTCCCCAGCTCTACTTAGCTGTTGGCATCTCG
GGTGCAATTCAGCACTTAGCTGGCATGAAAGACAGCAAGACAATTGCAGCCATCAACAAGGATGCTGATGCCCCT
ATCTTCCAGGTAGCGGACGTCGGGCTGGTAGGGGATCTTTTCGAGATAGTGCCCAAGTTGACAGACAAAGTGAAA
GGCTCTTGA
Gene >Ophun1|3324
ATGTCCGCCAAGATCATCAGCATTTCTGGTGTAGGAAGGCATCTGTTCAGGACAAACCGGAGTCTTCGTCCTGGC
CCATTGGCCTTGTCCATATCGTCCAAGAGAAGACTCCTGGCGACACTGGCAGTGCTTGAACAACGGGACGGCAAA
CTACATGAGGCTTCGCTTCGGACCCTGACAGCAGCTAAAAACTTGGGCGGGAGTGTTCATGCGTTCTTAGCCGGG
AGCAGTGTTTCCGCCGCAGCCGAGGATGCAGCCAAAGTTGACGGCGTGGAGCAAGTCACTGTTGTCGAGAACGCT
GCATATGAGAAGGTCACCCGTCACTGCTTCGATATTTCCTCGCTCTCCGACGGGGCAGGAATGCTGACCCGGTCG
CCAGGCACTCCCTGAAAACTACGCTCAATTACTGGCCGAAAACGTCAAAAAGGGAGGCTATACACACATCGTCGC
CGGTCACTCGTCATTCGGGAAGAACACGCTACCCAGAGTCGCGGCTCTGCTCGATTCGCAGCAAATATCCGACAT
AACGTCAATTGAAAACGAGACAACGTTCGTCCGGCCTATTTATGCGGGAAATGCCATTTCGACAGTTGAGTCTTC
AGACCAAGTCAAAGTTATTACAATTCGGGGAACTGCCTTTGAAGCTCCTGCAATAGGGTCAAAGTCAGCCACCGT
GACAACTGGCGTGGATCCCCAGGCAGAGTCGCCTACTGAATGGATTTCGGAGGATCTTGCCAAATCAGACCGTCC
CGAGCTGGCCCAGGCTAGCAAAGTTATTTCAGGTGGCCGCGGACTCAAGTCCAAGGAAGACTTTGACAGGCTGAT
ACTGCCCCTCGCCGATGCTCTGGGTGCGGCTGTTGGGGCATCGCGGGCTGCCGTTGACAGCGGCTACGCGGATAA
TGCCCTCCAGGTGGGACAGACCGGCAAGGTCGTTGCTCCCCAGCTCTACTTAGCTGTTGGCATCTCGGGTGCAAT
TCAGCACTTAGCTGGCATGAAAGACAGCAAGACAATTGCAGCCATCAACAAGGATGCTGATGCCCCTATCTTCCA
GGTAGCGGACGTCGGGCTGGTAGGGGATCTTTTCGAGATAGTGCCCAAGTTGACAGACAAAGTGAAAGGCTCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail