Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3323
Gene name
LocationContig_297:11372..11880
Strand-
Gene length (bp)508
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MZC4|CRLS1_DROME Probable cardiolipin synthase (CMP-forming) OS=Drosophila melanogaster GN=CLS PE=2 SV=1 1 129 2.0E-20
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 1 88 3.0E-18
sp|Q07560|CRD1_YEAST Cardiolipin synthase (CMP-forming) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRD1 PE=1 SV=1 1 129 1.0E-17
sp|Q9UJA2|CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens GN=CRLS1 PE=1 SV=1 1 129 4.0E-17
sp|Q5U2V5|CRLS1_RAT Cardiolipin synthase (CMP-forming) OS=Rattus norvegicus GN=Crls1 PE=2 SV=1 1 129 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MZC4|CRLS1_DROME Probable cardiolipin synthase (CMP-forming) OS=Drosophila melanogaster GN=CLS PE=2 SV=1 1 129 2.0E-20
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 1 88 3.0E-18
sp|Q07560|CRD1_YEAST Cardiolipin synthase (CMP-forming) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRD1 PE=1 SV=1 1 129 1.0E-17
sp|Q9UJA2|CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens GN=CRLS1 PE=1 SV=1 1 129 4.0E-17
sp|Q5U2V5|CRLS1_RAT Cardiolipin synthase (CMP-forming) OS=Rattus norvegicus GN=Crls1 PE=2 SV=1 1 129 6.0E-17
sp|Q80ZM8|CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus GN=Crls1 PE=1 SV=1 1 129 7.0E-17
sp|O01916|CRLS1_CAEEL Probable cardiolipin synthase (CMP-forming) OS=Caenorhabditis elegans GN=crls-1 PE=3 SV=1 1 127 9.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 98 120 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3323
MADKALMTILTVCLAVKGALPVWVATIILGRDICLGLAAIHYRWVSLPPPKTFARYWNFSLPSAEVRPTTISKYN
TFLQLILVGLTTAAPLMDIDISLPLTILQYIVAVTTMWSGLSYIVSKDAVKILR*
Coding >Ophun1|3323
ATGGCGGACAAGGCACTGATGACAATCTTGACCGTCTGCCTGGCTGTCAAAGGCGCTTTGCCAGTCTGGGTGGCG
ACCATTATATTGGGACGTGACATTTGCTTGGGTCTGGCAGCCATTCACTACCGATGGGTTTCCCTACCGCCCCCT
AAGACCTTTGCCCGCTACTGGAACTTCTCCTTGCCTTCTGCCGAGGTGCGACCAACCACCATCAGCAAGTACAAC
ACGTTCCTGCAGCTCATCCTTGTTGGCTTAACTACGGCTGCTCCACTGATGGATATCGATATATCTCTACCGCTC
ACGATATTGCAATATATCGTGGCTGTGACGACAATGTGGAGCGGCCTCAGCTACATAGTCAGCAAGGACGCCGTC
AAAATCCTTAGGTGA
Transcript >Ophun1|3323
ATGGCGGACAAGGCACTGATGACAATCTTGACCGTCTGCCTGGCTGTCAAAGGCGCTTTGCCAGTCTGGGTGGCG
ACCATTATATTGGGACGTGACATTTGCTTGGGTCTGGCAGCCATTCACTACCGATGGGTTTCCCTACCGCCCCCT
AAGACCTTTGCCCGCTACTGGAACTTCTCCTTGCCTTCTGCCGAGGTGCGACCAACCACCATCAGCAAGTACAAC
ACGTTCCTGCAGCTCATCCTTGTTGGCTTAACTACGGCTGCTCCACTGATGGATATCGATATATCTCTACCGCTC
ACGATATTGCAATATATCGTGGCTGTGACGACAATGTGGAGCGGCCTCAGCTACATAGTCAGCAAGGACGCCGTC
AAAATCCTTAGGTGA
Gene >Ophun1|3323
ATGGCGGACAAGGCACTGATGACAATCTTGACCGTCTGCCTGGCTGTCAAAGGCGCTTTGCCAGGTACGTCCGAC
CCGTGTCTTGTCCGGACTCAAACTGACGAGTCCAGCAGTCTGGGTGGCGACCATTATATTGGGACGTGACATTTG
CTTGGGTCTGGCAGCCATTCACTACCGATGGGTTTCCCTACCGCCCCCTAAGACCTTTGCCCGCTACTGGAACTT
CTCCTTGCCTTCTGCCGAGGTGCGACCAACCACCATCAGCAAGTACAACACGTTCCTGCAGCTCATCCTTGTTGG
CTTAACTACGGCTGCTCCACTGATGGATATCGATATATCTCTACCGCTCACGATATTGCAGTGAGTGCGCAAAAT
TCGTACCTACTGACTGGTCGTGTAGCTGATCTGTGTTTGACTCATCACTATCAGATATATCGTGGCTGTGACGAC
AATGTGGAGCGGCCTCAGCTACATAGTCAGCAAGGACGCCGTCAAAATCCTTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail