Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3320
Gene name
LocationContig_297:2664..4392
Strand+
Gene length (bp)1728
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 1.6E-54 113 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42916|ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ale1 PE=1 SV=1 15 475 5.0E-128
sp|Q08548|ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALE1 PE=1 SV=1 15 525 5.0E-120
sp|Q9CAN8|MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana GN=LPLAT2 PE=1 SV=1 89 460 1.0E-44
sp|F4IDU4|MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana GN=LPLAT1 PE=1 SV=1 12 467 2.0E-43
sp|Q6ZWT7|MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2 92 449 9.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42916|ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ale1 PE=1 SV=1 15 475 5.0E-128
sp|Q08548|ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALE1 PE=1 SV=1 15 525 5.0E-120
sp|Q9CAN8|MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana GN=LPLAT2 PE=1 SV=1 89 460 1.0E-44
sp|F4IDU4|MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana GN=LPLAT1 PE=1 SV=1 12 467 2.0E-43
sp|Q6ZWT7|MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens GN=MBOAT2 PE=2 SV=2 92 449 9.0E-41
sp|Q5ZKL6|MBOA2_CHICK Membrane-bound O-acyltransferase domain-containing protein 2 OS=Gallus gallus GN=mboat2 PE=2 SV=1 76 509 3.0E-40
sp|Q8R3I2|MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus GN=Mboat2 PE=1 SV=1 87 449 1.0E-39
sp|Q8BH98|MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus GN=Mboat1 PE=1 SV=1 91 450 2.0E-39
sp|Q3T1J2|MBOA2_RAT Membrane-bound O-acyltransferase domain-containing protein 2 OS=Rattus norvegicus GN=Mboat2 PE=2 SV=2 87 480 6.0E-38
sp|Q6ZNC8|MBOA1_HUMAN Lysophospholipid acyltransferase 1 OS=Homo sapiens GN=MBOAT1 PE=1 SV=1 91 490 5.0E-36
sp|Q91V01|MBOA5_MOUSE Lysophospholipid acyltransferase 5 OS=Mus musculus GN=Lpcat3 PE=1 SV=1 118 476 6.0E-36
sp|Q6P1A2|MBOA5_HUMAN Lysophospholipid acyltransferase 5 OS=Homo sapiens GN=LPCAT3 PE=1 SV=1 15 476 5.0E-33
sp|Q5FVN0|MBOA5_RAT Lysophospholipid acyltransferase 5 OS=Rattus norvegicus GN=Lpcat3 PE=2 SV=1 118 476 6.0E-33
sp|Q3SZL3|MBOA5_BOVIN Lysophospholipid acyltransferase 5 OS=Bos taurus GN=LPCAT3 PE=2 SV=1 15 476 3.0E-32
sp|Q9VVX5|MBOA5_DROME Lysophospholipid acyltransferase 5 OS=Drosophila melanogaster GN=nes PE=1 SV=1 12 499 7.0E-32
sp|O01925|MBOA5_CAEEL Lysophospholipid acyltransferase 5 OS=Caenorhabditis elegans GN=mboa-6 PE=1 SV=2 15 460 8.0E-24
sp|Q7SZQ0|MBOA7_DANRE Lysophospholipid acyltransferase 7 OS=Danio rerio GN=mboat7 PE=2 SV=1 153 482 4.0E-23
sp|Q19468|MBOA7_CAEEL Lysophospholipid acyltransferase 7 OS=Caenorhabditis elegans GN=mboa-7 PE=1 SV=2 43 450 8.0E-17
sp|A8WXS4|MBOA7_CAEBR Lysophospholipid acyltransferase 7 OS=Caenorhabditis briggsae GN=mboa-7 PE=3 SV=1 44 450 9.0E-17
sp|Q5U4T9|MBOA7_XENLA Lysophospholipid acyltransferase 7 OS=Xenopus laevis GN=mboat7 PE=2 SV=1 143 485 7.0E-16
sp|Q0VCY6|MBOA7_BOVIN Lysophospholipid acyltransferase 7 OS=Bos taurus GN=MBOAT7 PE=2 SV=1 158 449 1.0E-14
sp|B1Q006|MBOA4_DANRE Ghrelin O-acyltransferase OS=Danio rerio GN=mboat4 PE=2 SV=1 150 447 1.0E-13
sp|Q8CHK3|MBOA7_MOUSE Lysophospholipid acyltransferase 7 OS=Mus musculus GN=Mboat7 PE=1 SV=1 158 450 3.0E-13
sp|Q96N66|MBOA7_HUMAN Lysophospholipid acyltransferase 7 OS=Homo sapiens GN=MBOAT7 PE=1 SV=2 158 449 6.0E-13
sp|P0C7A3|MBOA4_MOUSE Ghrelin O-acyltransferase OS=Mus musculus GN=Mboat4 PE=1 SV=1 96 428 1.0E-08
sp|Q9JJJ7|PORCN_MOUSE Protein-serine O-palmitoleoyltransferase porcupine OS=Mus musculus GN=Porcn PE=1 SV=1 107 382 7.0E-07
sp|Q9H237|PORCN_HUMAN Protein-serine O-palmitoleoyltransferase porcupine OS=Homo sapiens GN=PORCN PE=1 SV=2 107 382 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 31 21
2 43 65 22
3 85 104 19
4 268 290 22
5 360 382 22
6 415 437 22
7 441 463 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3320
MRLHFTDKMLVVLPVKIIVSFLLSYPLAGVLKRVPDSKPGYKNLFIIGISIFYMVGLFDLWRGLGTLLFSAAGAY
GIAYYLQKSPYMPWIGFVFLMCHMSFSHIRRQISNDPTTVDITGAQMVMVMKLSAFCWNVADGQLPAEHLTDHQK
DRALSAPPSLLDYAGYVLFFPSLFAGPAFDYVEYRRWIDTSMFDVPADVDSSKRPPVRKKRRIPRSGTPATIKAI
QGLCWIGLFVTLSSRFGYEQLVDESYMQYGLLRRIWIMCMANFVARLKYYGVWSLTEGSCILAGLGYNGVDPVTG
KVSWNRLQNISPWLVETAQNPREYMAGWNINTNNWLRNYVYLRVTPRGKKPGFRASMTTFATSALWHGFYPGYYL
SFVLASLIQTAAKNFRRLVRPFFLDPVTGEATSSKKYYDAMSYIATQTTFAFVATPFLLLSFKDSIHAWSCVYYY
GLVWTIACMIFFASPCKGMLRTKLEKGHAQNNPKLLRSLSTESLKGKEPILGISKDLEQDVSEAVEEFKAEVRAR
QRKMS*
Coding >Ophun1|3320
ATGCGCTTGCACTTTACTGACAAGATGCTCGTCGTCCTACCAGTCAAGATCATAGTCTCCTTTCTCTTGTCCTAT
CCTCTGGCCGGCGTCTTAAAGCGAGTTCCAGACTCTAAACCTGGATACAAGAACCTCTTCATTATTGGCATATCC
ATCTTTTACATGGTTGGTCTCTTCGACCTCTGGCGCGGCCTCGGAACACTACTGTTCAGCGCAGCCGGCGCATAC
GGAATCGCGTACTATCTACAAAAGAGCCCGTACATGCCATGGATCGGCTTCGTCTTCCTCATGTGCCACATGTCT
TTTAGTCACATCCGGCGGCAGATCTCCAACGACCCGACGACGGTGGACATCACCGGAGCGCAAATGGTCATGGTG
ATGAAGCTAAGCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCTGAGCACCTGACGGATCACCAGAAA
GATCGCGCCCTTTCGGCGCCGCCGTCGCTGCTCGACTACGCTGGATACGTTCTCTTCTTTCCGAGTCTGTTCGCT
GGCCCGGCTTTCGACTATGTCGAGTATCGACGTTGGATCGACACTTCCATGTTCGATGTCCCCGCCGATGTCGAT
AGTTCCAAAAGACCCCCCGTGAGGAAGAAGCGCAGGATCCCGCGGAGCGGTACCCCGGCCACCATCAAGGCCATT
CAGGGCCTCTGTTGGATCGGTCTGTTCGTCACGTTGTCGTCGCGATTTGGCTATGAGCAGCTGGTTGACGAGTCG
TACATGCAGTATGGCCTGTTGCGGCGTATCTGGATCATGTGCATGGCGAATTTCGTCGCCAGGCTCAAGTACTAC
GGTGTCTGGTCCCTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGGTATAATGGCGTTGATCCCGTTACCGGT
AAAGTCTCGTGGAACCGATTGCAGAACATCAGTCCTTGGCTGGTGGAGACGGCCCAGAACCCGCGAGAGTATATG
GCTGGATGGAACATTAACACAAATAATTGGCTCAGGAACTACGTCTATCTTCGTGTCACGCCCAGGGGCAAGAAG
CCGGGCTTTCGTGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCATGGCTTTTACCCCGGCTACTACCTG
TCCTTTGTTCTCGCCAGTCTGATCCAGACAGCTGCCAAGAACTTCCGTCGCCTCGTCCGCCCTTTCTTCCTCGAT
CCCGTCACGGGCGAAGCTACCTCGAGCAAAAAGTACTACGACGCCATGAGCTACATCGCCACGCAGACAACCTTT
GCCTTCGTCGCCACGCCCTTCCTCCTGCTATCCTTCAAGGACTCCATCCACGCTTGGTCGTGTGTGTACTATTAC
GGCCTCGTCTGGACCATTGCGTGCATGATCTTCTTCGCCTCGCCATGCAAGGGCATGCTCAGGACCAAGTTGGAG
AAGGGCCATGCGCAGAACAACCCGAAGCTGTTGCGGTCCCTCAGCACCGAAAGTCTTAAAGGAAAAGAACCCATC
CTCGGCATCTCCAAAGATCTCGAACAGGACGTGAGTGAAGCTGTCGAGGAGTTCAAGGCTGAAGTCCGGGCTCGG
CAAAGGAAGATGTCGTGA
Transcript >Ophun1|3320
ATGCGCTTGCACTTTACTGACAAGATGCTCGTCGTCCTACCAGTCAAGATCATAGTCTCCTTTCTCTTGTCCTAT
CCTCTGGCCGGCGTCTTAAAGCGAGTTCCAGACTCTAAACCTGGATACAAGAACCTCTTCATTATTGGCATATCC
ATCTTTTACATGGTTGGTCTCTTCGACCTCTGGCGCGGCCTCGGAACACTACTGTTCAGCGCAGCCGGCGCATAC
GGAATCGCGTACTATCTACAAAAGAGCCCGTACATGCCATGGATCGGCTTCGTCTTCCTCATGTGCCACATGTCT
TTTAGTCACATCCGGCGGCAGATCTCCAACGACCCGACGACGGTGGACATCACCGGAGCGCAAATGGTCATGGTG
ATGAAGCTAAGCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCTGAGCACCTGACGGATCACCAGAAA
GATCGCGCCCTTTCGGCGCCGCCGTCGCTGCTCGACTACGCTGGATACGTTCTCTTCTTTCCGAGTCTGTTCGCT
GGCCCGGCTTTCGACTATGTCGAGTATCGACGTTGGATCGACACTTCCATGTTCGATGTCCCCGCCGATGTCGAT
AGTTCCAAAAGACCCCCCGTGAGGAAGAAGCGCAGGATCCCGCGGAGCGGTACCCCGGCCACCATCAAGGCCATT
CAGGGCCTCTGTTGGATCGGTCTGTTCGTCACGTTGTCGTCGCGATTTGGCTATGAGCAGCTGGTTGACGAGTCG
TACATGCAGTATGGCCTGTTGCGGCGTATCTGGATCATGTGCATGGCGAATTTCGTCGCCAGGCTCAAGTACTAC
GGTGTCTGGTCCCTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGGTATAATGGCGTTGATCCCGTTACCGGT
AAAGTCTCGTGGAACCGATTGCAGAACATCAGTCCTTGGCTGGTGGAGACGGCCCAGAACCCGCGAGAGTATATG
GCTGGATGGAACATTAACACAAATAATTGGCTCAGGAACTACGTCTATCTTCGTGTCACGCCCAGGGGCAAGAAG
CCGGGCTTTCGTGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCATGGCTTTTACCCCGGCTACTACCTG
TCCTTTGTTCTCGCCAGTCTGATCCAGACAGCTGCCAAGAACTTCCGTCGCCTCGTCCGCCCTTTCTTCCTCGAT
CCCGTCACGGGCGAAGCTACCTCGAGCAAAAAGTACTACGACGCCATGAGCTACATCGCCACGCAGACAACCTTT
GCCTTCGTCGCCACGCCCTTCCTCCTGCTATCCTTCAAGGACTCCATCCACGCTTGGTCGTGTGTGTACTATTAC
GGCCTCGTCTGGACCATTGCGTGCATGATCTTCTTCGCCTCGCCATGCAAGGGCATGCTCAGGACCAAGTTGGAG
AAGGGCCATGCGCAGAACAACCCGAAGCTGTTGCGGTCCCTCAGCACCGAAAGTCTTAAAGGAAAAGAACCCATC
CTCGGCATCTCCAAAGATCTCGAACAGGACGTGAGTGAAGCTGTCGAGGAGTTCAAGGCTGAAGTCCGGGCTCGG
CAAAGGAAGATGTCGTGA
Gene >Ophun1|3320
ATGCGCTTGCACTTTACTGACAAGATGCTCGTCGTCCTACCAGTCAAGATCATAGTCTCCTTTCTCTTGTCCTAT
CCTCTGGCCGGCGTCTTAAAGCGAGTTCCAGACTCTAAACCTGGATACAAGAACCTCTTCATTATTGGGTACGCC
TCTTCTTCCCTTGTTGTCGCTGCCTGCGGTGCCTTTCTGACCTGAGTTGCGTGGACAGCATATCCATCTTTTACA
TGGTTGGTCTCTTCGACCTCTGGCGCGGCCTCGGAACACTACTGTTCAGCGCAGCCGGCGCATACGGAATCGCGT
ACTATCTACAAAAGAGCCCGTACATGCCATGGATCGGCTTCGTCTTCCTCATGTGCCACATGTCTTTTAGTCACA
TCCGGCGGCAGATCTCCAACGACCCGACGACGGTGGACATCACCGGAGCGCAAATGGTCATGGTGATGAAGCTAA
GCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCTGAGCACCTGACGGATCACCAGAAAGATCGCGCCC
TTTCGGCGCCGCCGTCGCTGCTCGACTACGCTGGATACGTTCTCTTCTTTCCGAGTCTGTTCGCTGGCCCGGCTT
TCGACTATGTCGAGTATCGACGTTGGATCGACACTTCCATGTTCGATGTCCCCGCCGATGTCGATAGTTCCAAAA
GACCCCCCGTGAGGAAGAAGCGCAGGATCCCGCGGAGCGGTACCCCGGCCACCATCAAGGCCATTCAGGGCCTCT
GTTGGATCGGTCTGTTCGTCACGTTGTCGTCGCGATTTGGCTATGAGCAGCTGGTTGACGAGTCGTACATGCAGT
ATGGCCTGTTGCGGCGTATCTGGATCATGTGCATGGCGAATTTCGTCGCCAGGCTCAAGTACTACGGTGTCTGGT
CCCTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGGTATAATGGCGTTGATCCCGTTACCGGTAAAGTCTCGT
GGAACCGATTGCAGAACATCAGTCCTTGGCTGGTGGAGACGGCCCAGAACCCGCGAGAGTATATGGCTGGATGGA
ACATTAACACAAATAATTGGCTCAGGAACTACGTCTATCTTCGTGTCACGCCCAGGGGCAAGAAGCCGGGCTTTC
GTGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCATGGCTTTTACCCCGGCTACTACCTGTCCTTTGTTC
TCGCCAGTCTGATCCAGACAGCTGCCAAGAGTAAGTCGTCATGAGCCCGTGACTCGGCCGGCAAAGTGCTTGGTT
GTGCTAATGAATCATGGGCTCGTAGACTTCCGTCGCCTCGTCCGCCCTTTCTTCCTCGATCCCGTCACGGGCGAA
GCTACCTCGAGCAAAAAGTACTACGACGCCATGAGCTACATCGCCACGCAGACAACCTTTGCCTTCGTCGCCACG
CCCTTCCTCCTGCTATCCTTCAAGGACTCCATCCACGCTTGGTCGTGTGTGTACTATTACGGCCTCGTCTGGACC
ATTGCGTGCATGATCTTCTTCGCCTCGCCATGCAAGGGCATGCTCAGGACCAAGTTGGAGAAGGGCCATGCGCAG
AACAACCCGAAGCTGTTGCGGTCCCTCAGCACCGAAAGTCTTAAAGGAAAAGAACCCATCCTCGGCATCTCCAAA
GATCTCGAACAGGACGTGAGTGAAGCTGTCGAGGAGTTCAAGGCTGAAGTCCGGGCTCGGCAAAGGAAGATGTCG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail