Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|332
Gene name
LocationContig_109:33255..35586
Strand+
Gene length (bp)2331
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00250 Forkhead Forkhead domain 7.6E-35 196 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 183 284 2.0E-36
sp|O13606|MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei4 PE=3 SV=1 185 327 9.0E-28
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 196 317 1.0E-27
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 196 339 6.0E-27
sp|Q63ZH2|FXI2B_XENLA Forkhead box protein I2-B OS=Xenopus laevis GN=foxi2-b PE=2 SV=2 196 334 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 183 284 2.0E-36
sp|O13606|MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei4 PE=3 SV=1 185 327 9.0E-28
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 196 317 1.0E-27
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 196 339 6.0E-27
sp|Q63ZH2|FXI2B_XENLA Forkhead box protein I2-B OS=Xenopus laevis GN=foxi2-b PE=2 SV=2 196 334 1.0E-26
sp|Q7ZYQ0|FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis GN=foxi1e PE=2 SV=1 196 289 1.0E-26
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 196 289 2.0E-26
sp|Q6ZQN5|FOXI2_HUMAN Forkhead box protein I2 OS=Homo sapiens GN=FOXI2 PE=2 SV=2 196 316 3.0E-26
sp|Q91905|FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis GN=foxi1-b PE=2 SV=1 196 339 5.0E-26
sp|Q5NDM2|FXI2A_XENLA Forkhead box protein I2-A OS=Xenopus laevis GN=foxi2-a PE=2 SV=1 196 323 9.0E-26
sp|Q28HT3|FOXI2_XENTR Forkhead box protein I2 OS=Xenopus tropicalis GN=foxi2 PE=2 SV=1 196 296 1.0E-25
sp|Q922I5|FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus GN=Foxi1 PE=2 SV=2 196 280 1.0E-25
sp|Q91904|FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis GN=foxi1-a PE=1 SV=1 196 339 2.0E-25
sp|Q63248|FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus GN=Foxi2 PE=2 SV=1 196 280 2.0E-25
sp|Q8JIT5|FXI1C_XENLA Forkhead box protein I1c OS=Xenopus laevis GN=foxi1c PE=2 SV=1 196 280 3.0E-25
sp|Q3I5G5|FOXI2_MOUSE Forkhead box protein I2 OS=Mus musculus GN=Foxi2 PE=2 SV=1 196 280 4.0E-25
sp|Q28D67|FXI1C_XENTR Forkhead box protein I1c OS=Xenopus tropicalis GN=foxi1c PE=2 SV=1 196 280 1.0E-24
sp|Q01167|FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens GN=FOXK2 PE=1 SV=3 193 305 1.0E-24
sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=1 SV=3 193 305 1.0E-24
sp|A8MTJ6|FOXI3_HUMAN Forkhead box protein I3 OS=Homo sapiens GN=FOXI3 PE=2 SV=3 196 292 1.0E-24
sp|P42128|FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus GN=Foxk1 PE=1 SV=2 193 288 2.0E-24
sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 193 305 2.0E-24
sp|P32030|SLP1_DROME Fork head domain transcription factor slp1 OS=Drosophila melanogaster GN=slp1 PE=2 SV=1 193 310 2.0E-24
sp|O00358|FOXE1_HUMAN Forkhead box protein E1 OS=Homo sapiens GN=FOXE1 PE=1 SV=3 196 280 2.0E-24
sp|Q32NH9|FXJ12_XENLA Forkhead box protein J1.2 OS=Xenopus laevis GN=foxj1.2 PE=2 SV=1 196 321 2.0E-24
sp|B5RHS5|FOXI3_CANLF Forkhead box protein I3 OS=Canis lupus familiaris GN=FOXI3 PE=3 SV=1 196 288 3.0E-24
sp|P56260|QIN_AVIS3 Transforming protein Qin OS=Avian sarcoma virus (strain 31) GN=V-QIN PE=2 SV=1 196 292 3.0E-24
sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens GN=FOXK1 PE=1 SV=1 193 288 4.0E-24
sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens GN=FOXJ3 PE=1 SV=2 193 273 6.0E-24
sp|Q8ITI5|FOXG1_MNELE Forkhead box protein G1 OS=Mnemiopsis leidyi GN=FOXG1 PE=2 SV=1 195 307 6.0E-24
sp|Q68EZ2|FOXJ2_XENLA Forkhead box protein J2 OS=Xenopus laevis GN=foxj2 PE=2 SV=1 193 273 6.0E-24
sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus GN=Foxj3 PE=1 SV=1 193 273 7.0E-24
sp|Q64731|FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus GN=Foxl1 PE=2 SV=2 195 347 7.0E-24
sp|F1QDF8|FXJ1A_DANRE Forkhead box protein J1-A OS=Danio rerio GN=foxj1a PE=2 SV=1 196 303 8.0E-24
sp|Q9YHC5|FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis GN=foxg1 PE=2 SV=1 196 292 8.0E-24
sp|Q28EM1|FOXJ2_XENTR Forkhead box protein J2 OS=Xenopus tropicalis GN=foxj2 PE=2 SV=1 193 273 9.0E-24
sp|Q8R2I0|FOXE1_MOUSE Forkhead box protein E1 OS=Mus musculus GN=Foxe1 PE=1 SV=2 196 280 9.0E-24
sp|P25364|HCM1_YEAST Forkhead transcription factor HCM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCM1 PE=1 SV=3 196 282 1.0E-23
sp|Q90964|FOXG1_CHICK Forkhead box protein G1 OS=Gallus gallus GN=FOXG1 PE=2 SV=1 196 281 1.0E-23
sp|Q60987|FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus GN=Foxg1 PE=2 SV=1 196 281 1.0E-23
sp|Q00939|FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus GN=Foxg1 PE=2 SV=1 196 281 1.0E-23
sp|Q66IG8|FXJ12_XENTR Forkhead box protein J1.2 OS=Xenopus tropicalis GN=foxj1.2 PE=2 SV=1 196 293 1.0E-23
sp|Q1A1A1|FOXG1_CERSI Forkhead box protein G1 OS=Ceratotherium simum GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|Q1A1A2|FOXG1_EQUBU Forkhead box protein G1 OS=Equus burchelli GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|Q1A1A6|FOXG1_CEBCA Forkhead box protein G1 OS=Cebus capucinus GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|Q1A1A4|FOXG1_PIPRU Forkhead box protein G1 OS=Pipistrellus rusticus GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|Q1A1A3|FOXG1_EPOGA Forkhead box protein G1 OS=Epomophorus gambianus GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|P55316|FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens GN=FOXG1 PE=1 SV=2 196 292 2.0E-23
sp|Q1A1A5|FOXG1_CHLPG Forkhead box protein G1 OS=Chlorocebus pygerythrus GN=FOXG1 PE=3 SV=1 196 292 2.0E-23
sp|Q5J3Q5|FOXE1_XENLA Forkhead box protein E1 OS=Xenopus laevis GN=foxe1 PE=2 SV=1 196 345 2.0E-23
sp|P32031|SLP2_DROME Fork head domain transcription factor slp2 OS=Drosophila melanogaster GN=slp2 PE=2 SV=2 196 281 5.0E-23
sp|Q9PTK2|FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis GN=foxe4 PE=2 SV=1 196 280 5.0E-23
sp|Q9QY14|FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus GN=Foxe3 PE=1 SV=1 196 280 7.0E-23
sp|Q63250|FOXE3_RAT Forkhead box protein E3 OS=Rattus norvegicus GN=Foxe3 PE=2 SV=2 196 280 8.0E-23
sp|Q92949|FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens GN=FOXJ1 PE=2 SV=3 196 316 9.0E-23
sp|Q13461|FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens GN=FOXE3 PE=1 SV=2 196 280 9.0E-23
sp|Q63247|FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus GN=Foxj1 PE=2 SV=1 196 291 1.0E-22
sp|Q61660|FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus GN=Foxj1 PE=2 SV=2 196 291 2.0E-22
sp|Q708W1|FXJ1B_XENLA Forkhead box protein J1-B OS=Xenopus laevis GN=foxj1-b PE=2 SV=1 196 274 3.0E-22
sp|F1R8Z9|FXJ1B_DANRE Forkhead box protein J1-B OS=Danio rerio GN=foxj1b PE=2 SV=1 196 293 4.0E-22
sp|Q5M7N6|FOXJ1_XENTR Forkhead box protein J1 OS=Xenopus tropicalis GN=foxj1 PE=2 SV=2 196 274 4.0E-22
sp|Q61574|FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus GN=Foxs1 PE=2 SV=2 196 280 8.0E-22
sp|A1L1S5|FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio GN=foxf1 PE=2 SV=1 196 280 1.0E-21
sp|Q12946|FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens GN=FOXF1 PE=1 SV=2 196 280 1.0E-21
sp|O43638|FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens GN=FOXS1 PE=2 SV=2 196 280 1.0E-21
sp|Q6F2E4|FOXD1_XENTR Forkhead box protein D1 OS=Xenopus tropicalis GN=foxd1 PE=2 SV=1 196 280 1.0E-21
sp|Q9W707|FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis GN=foxf1-b PE=2 SV=1 196 280 1.0E-21
sp|P79772|FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus GN=FOXD3 PE=2 SV=1 196 280 1.0E-21
sp|Q6VFT6|FOXL2_PIG Forkhead box protein L2 OS=Sus scrofa GN=FOXL2 PE=3 SV=1 192 282 1.0E-21
sp|O88470|FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus GN=Foxl2 PE=1 SV=2 192 282 1.0E-21
sp|Q9W706|FXF1A_XENLA Forkhead box protein F1-A OS=Xenopus laevis GN=foxf1-a PE=2 SV=1 196 280 2.0E-21
sp|O54743|FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus GN=Foxf2 PE=2 SV=2 196 280 2.0E-21
sp|Q6VFT5|FOXL2_RABIT Forkhead box protein L2 OS=Oryctolagus cuniculus GN=FOXL2 PE=3 SV=1 192 282 2.0E-21
sp|Q63245|FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus GN=Foxd3 PE=1 SV=1 196 280 2.0E-21
sp|Q4VUF1|FOXL2_ELLLU Forkhead box protein L2 OS=Ellobius lutescens GN=FOXL2 PE=3 SV=1 192 282 2.0E-21
sp|Q63251|FOXD1_RAT Forkhead box protein D1 (Fragment) OS=Rattus norvegicus GN=Foxd1 PE=2 SV=1 196 274 2.0E-21
sp|Q61080|FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus GN=Foxf1 PE=2 SV=2 196 280 2.0E-21
sp|Q28BS5|FOXF1_XENTR Forkhead box protein F1 OS=Xenopus tropicalis GN=foxf1 PE=2 SV=1 196 280 2.0E-21
sp|Q9P0K8|FOXJ2_HUMAN Forkhead box protein J2 OS=Homo sapiens GN=FOXJ2 PE=1 SV=1 190 273 2.0E-21
sp|Q12947|FOXF2_HUMAN Forkhead box protein F2 OS=Homo sapiens GN=FOXF2 PE=1 SV=2 196 280 2.0E-21
sp|P58012|FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens GN=FOXL2 PE=1 SV=1 192 282 2.0E-21
sp|Q9ES18|FOXJ2_MOUSE Forkhead box protein J2 OS=Mus musculus GN=Foxj2 PE=2 SV=1 190 273 2.0E-21
sp|O35392|FOXD2_MOUSE Forkhead box protein D2 OS=Mus musculus GN=Foxd2 PE=2 SV=1 196 280 2.0E-21
sp|Q5M7L9|FOXD3_XENTR Forkhead box protein D3 OS=Xenopus tropicalis GN=foxd3 PE=2 SV=1 196 280 2.0E-21
sp|Q8MIP2|FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus GN=FOXL2 PE=1 SV=1 192 282 2.0E-21
sp|O60129|FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh2 PE=1 SV=1 193 320 3.0E-21
sp|P35583|FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus GN=Foxa2 PE=1 SV=2 196 364 3.0E-21
sp|Q9DE25|FXC1A_DANRE Forkhead box C1-A OS=Danio rerio GN=foxc1a PE=2 SV=1 196 332 3.0E-21
sp|Q6VFT7|FOXL2_BOVIN Forkhead box protein L2 OS=Bos taurus GN=FOXL2 PE=2 SV=1 192 282 3.0E-21
sp|Q9DEN3|FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis GN=foxd3-b PE=2 SV=1 196 280 3.0E-21
sp|Q61060|FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus GN=Foxd3 PE=2 SV=3 196 280 3.0E-21
sp|Q61345|FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus GN=Foxd1 PE=2 SV=2 196 280 3.0E-21
sp|O60548|FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens GN=FOXD2 PE=2 SV=2 196 280 4.0E-21
sp|P32183|FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus GN=Foxa3 PE=1 SV=1 196 288 4.0E-21
sp|Q12952|FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens GN=FOXL1 PE=2 SV=2 195 274 4.0E-21
sp|P35584|FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus GN=Foxa3 PE=1 SV=1 196 288 5.0E-21
sp|Q63249|FOXD4_RAT Forkhead box protein D4 (Fragment) OS=Rattus norvegicus GN=Foxd4 PE=2 SV=1 196 280 5.0E-21
sp|Q708W2|FXJ1A_XENLA Forkhead box protein J1-A OS=Xenopus laevis GN=foxj1-a PE=2 SV=1 196 274 5.0E-21
sp|Q12950|FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens GN=FOXD4 PE=2 SV=4 196 280 5.0E-21
sp|Q16676|FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens GN=FOXD1 PE=2 SV=1 196 280 5.0E-21
sp|Q3Y598|FOXA3_BOVIN Hepatocyte nuclear factor 3-gamma OS=Bos taurus GN=FOXA3 PE=2 SV=1 196 288 5.0E-21
sp|P55318|FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens GN=FOXA3 PE=1 SV=2 196 288 5.0E-21
sp|Q9PVY9|FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis GN=foxc2-a PE=2 SV=1 182 280 6.0E-21
sp|Q7T1R4|FOXA2_XENTR Forkhead box protein A2 OS=Xenopus tropicalis GN=foxa2 PE=2 SV=1 196 280 6.0E-21
sp|Q9UJU5|FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens GN=FOXD3 PE=1 SV=1 196 280 6.0E-21
sp|Q90WN4|FOXD2_XENLA Forkhead box protein D2 OS=Xenopus laevis GN=foxd2 PE=2 SV=1 196 280 6.0E-21
sp|Q32NP8|FXC1B_XENLA Forkhead box protein C1-B OS=Xenopus laevis GN=foxc1-b PE=2 SV=1 193 280 6.0E-21
sp|Q9DEN4|FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis GN=foxd3-a PE=1 SV=1 196 280 7.0E-21
sp|Q91765|FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis GN=foxa2-a PE=1 SV=1 196 280 7.0E-21
sp|Q9PVZ3|FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis GN=foxc1-a PE=2 SV=1 193 280 7.0E-21
sp|Q98937|FOXD1_CHICK Forkhead box protein D1 OS=Gallus gallus GN=FOXD1 PE=2 SV=1 196 280 7.0E-21
sp|Q60688|FOXD4_MOUSE Forkhead box protein D4 OS=Mus musculus GN=Foxd4 PE=2 SV=1 196 280 7.0E-21
sp|Q9PSY4|FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis GN=foxd1 PE=2 SV=2 196 280 7.0E-21
sp|Q6NVT7|FOXC2_XENTR Forkhead box protein C2 OS=Xenopus tropicalis GN=foxc2 PE=2 SV=2 182 280 7.0E-21
sp|Q5WM45|FOXD5_XENTR Forkhead box protein D5 OS=Xenopus tropicalis GN=foxd5 PE=2 SV=1 196 280 7.0E-21
sp|Q9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens GN=FOXA2 PE=1 SV=1 196 288 8.0E-21
sp|Q9PRJ8|FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis GN=foxd5-a PE=2 SV=1 196 280 8.0E-21
sp|Q9PVY8|FXC2B_XENLA Forkhead box protein C2-B OS=Xenopus laevis GN=foxc2-b PE=2 SV=2 196 280 8.0E-21
sp|Q9PT68|FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis GN=foxd5-b PE=2 SV=1 196 280 9.0E-21
sp|Q9DE24|FXC1B_DANRE Forkhead box C1-B OS=Danio rerio GN=foxc1b PE=2 SV=1 196 280 9.0E-21
sp|Q68F77|FOXC1_XENTR Forkhead box protein C1 OS=Xenopus tropicalis GN=foxc1 PE=2 SV=1 193 280 1.0E-20
sp|Q5VV16|FX4L5_HUMAN Forkhead box protein D4-like 5 OS=Homo sapiens GN=FOXD4L5 PE=3 SV=1 196 280 1.0E-20
sp|Q8WXT5|FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens GN=FOXD4L4 PE=2 SV=2 196 280 1.0E-20
sp|Q64732|FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus GN=Foxb1 PE=2 SV=2 195 309 1.0E-20
sp|Q99853|FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens GN=FOXB1 PE=1 SV=3 195 309 1.0E-20
sp|Q63246|FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus GN=Foxc2 PE=1 SV=2 135 280 1.0E-20
sp|Q3SYB3|FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens GN=FOXD4L6 PE=1 SV=2 196 280 1.0E-20
sp|Q61850|FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus GN=Foxc2 PE=1 SV=2 135 280 1.0E-20
sp|Q99958|FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens GN=FOXC2 PE=1 SV=1 135 337 1.0E-20
sp|Q6VB84|FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens GN=FOXD4L3 PE=2 SV=2 196 280 1.0E-20
sp|P55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens GN=FOXA1 PE=1 SV=2 196 288 1.0E-20
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 196 283 2.0E-20
sp|O42097|FOXA2_ORYLA Hepatocyte nuclear factor 3-beta OS=Oryzias latipes GN=foxa2 PE=2 SV=1 196 280 2.0E-20
sp|P35582|FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus GN=Foxa1 PE=1 SV=2 196 288 2.0E-20
sp|Q8AWH1|FOXA1_XENTR Forkhead box protein A1 OS=Xenopus tropicalis GN=foxa1 PE=2 SV=1 196 288 2.0E-20
sp|P32315|FXA1B_XENLA Forkhead box protein A1-B OS=Xenopus laevis GN=foxa1-b PE=2 SV=1 196 288 3.0E-20
sp|P23512|FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus GN=Foxa1 PE=1 SV=1 196 288 3.0E-20
sp|Q07342|FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio GN=foxa2 PE=2 SV=1 196 280 4.0E-20
sp|Q6LD29|FXA1A_XENLA Forkhead box protein A1-A OS=Xenopus laevis GN=foxa1-a PE=2 SV=2 196 280 4.0E-20
sp|Q12948|FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens GN=FOXC1 PE=1 SV=3 193 280 4.0E-20
sp|Q17381|PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans GN=pha-4 PE=1 SV=1 196 341 5.0E-20
sp|Q61572|FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus GN=Foxc1 PE=1 SV=3 193 280 5.0E-20
sp|Q9NU39|FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens GN=FOXD4L1 PE=2 SV=1 196 280 5.0E-20
sp|Q02361|FD3_DROME Fork head domain-containing protein FD3 OS=Drosophila melanogaster GN=fd59A PE=2 SV=2 196 316 5.0E-20
sp|P84961|FXA2B_XENLA Forkhead box protein A2-B OS=Xenopus laevis GN=foxa2-b PE=2 SV=1 196 280 6.0E-20
sp|P32027|CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster GN=croc PE=2 SV=2 196 308 7.0E-20
sp|P32182|FOXA2_RAT Hepatocyte nuclear factor 3-beta OS=Rattus norvegicus GN=Foxa2 PE=1 SV=1 196 280 7.0E-20
sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=3 SV=2 188 293 7.0E-20
sp|P33206|FXA4B_XENLA Forkhead box protein A4-B OS=Xenopus laevis GN=foxa4-b PE=2 SV=1 196 274 1.0E-19
sp|Q9PT67|FXD5C_XENLA Forkhead box protein D5-C OS=Xenopus laevis GN=foxd5-c PE=2 SV=1 196 280 2.0E-19
sp|Q6P839|FOXA4_XENTR Forkhead box protein A4 OS=Xenopus tropicalis GN=foxa4 PE=2 SV=1 196 288 2.0E-19
sp|Q02360|FD2_DROME Fork head domain-containing protein FD2 OS=Drosophila melanogaster GN=fd64A PE=2 SV=2 196 280 2.0E-19
sp|P34683|LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans GN=lin-31 PE=3 SV=1 180 280 2.0E-19
sp|Q17241|SGF1_BOMMO Silk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV=1 196 288 3.0E-19
sp|P33205|FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis GN=foxa4-a PE=1 SV=3 196 288 3.0E-19
sp|P14734|FKH_DROME Protein fork head OS=Drosophila melanogaster GN=fkh PE=1 SV=1 196 280 4.0E-19
sp|P32028|FD4_DROME Fork head domain-containing protein FD4 OS=Drosophila melanogaster GN=fd96Ca PE=2 SV=2 195 274 1.0E-18
sp|O93529|FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis GN=foxb1 PE=2 SV=1 195 288 2.0E-18
sp|P32029|FD5_DROME Fork head domain-containing protein FD5 OS=Drosophila melanogaster GN=fd96Cb PE=2 SV=2 195 274 2.0E-18
sp|P41813|FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH2 PE=1 SV=1 196 352 2.0E-18
sp|Q499D0|FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus GN=Foxn3 PE=1 SV=1 176 274 5.0E-18
sp|Q33BP8|FOXN3_PIG Forkhead box protein N3 OS=Sus scrofa GN=FOXN3 PE=2 SV=1 176 274 5.0E-18
sp|O00409|FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens GN=FOXN3 PE=1 SV=1 176 274 8.0E-18
sp|Q64733|FOXB2_MOUSE Forkhead box protein B2 OS=Mus musculus GN=Foxb2 PE=2 SV=1 196 288 9.0E-18
sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens GN=FOXB2 PE=3 SV=1 196 288 1.0E-17
sp|Q8JIT6|FOXB2_XENLA Forkhead box protein B2 OS=Xenopus laevis GN=foxb2 PE=2 SV=1 196 280 1.0E-17
sp|Q63244|FOXQ1_RAT Forkhead box protein Q1 OS=Rattus norvegicus GN=Foxq1 PE=1 SV=3 196 280 2.0E-17
sp|O70220|FOXQ1_MOUSE Forkhead box protein Q1 OS=Mus musculus GN=Foxq1 PE=2 SV=3 196 280 2.0E-17
sp|Q58NQ4|FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus GN=FOXP1 PE=2 SV=1 196 325 4.0E-17
sp|Q5W1J5|FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis GN=foxp1 PE=1 SV=1 196 325 4.0E-17
sp|Q9C009|FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens GN=FOXQ1 PE=2 SV=2 196 280 5.0E-17
sp|Q4VYR7|FOXP4_XENLA Forkhead box protein P4 OS=Xenopus laevis GN=foxp4 PE=2 SV=1 196 284 5.0E-17
sp|Q28G71|FOXN3_XENTR Forkhead box protein N3 OS=Xenopus tropicalis GN=foxn3 PE=2 SV=1 176 274 7.0E-17
sp|A4IFD2|FOXP1_BOVIN Forkhead box protein P1 OS=Bos taurus GN=FOXP1 PE=2 SV=1 196 279 9.0E-17
sp|P40466|FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH1 PE=1 SV=1 196 283 9.0E-17
sp|Q99JB6|FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus GN=Foxp3 PE=1 SV=1 196 287 9.0E-17
sp|P58462|FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus GN=Foxp1 PE=1 SV=1 196 279 9.0E-17
sp|Q498D1|FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus GN=Foxp1 PE=1 SV=1 196 279 9.0E-17
sp|Q9VS05|FOXF_DROME Forkhead box protein biniou OS=Drosophila melanogaster GN=bin PE=1 SV=2 196 288 1.0E-16
sp|Q9H334|FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens GN=FOXP1 PE=1 SV=1 196 279 1.0E-16
sp|Q8IVH2|FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens GN=FOXP4 PE=1 SV=1 196 273 1.0E-16
sp|O15409|FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens GN=FOXP2 PE=1 SV=2 196 297 1.0E-16
sp|Q8MJ98|FOXP2_PONPY Forkhead box protein P2 OS=Pongo pygmaeus GN=FOXP2 PE=2 SV=3 196 297 1.0E-16
sp|Q5QL03|FOXP2_HYLLA Forkhead box protein P2 OS=Hylobates lar GN=FOXP2 PE=3 SV=1 196 297 1.0E-16
sp|Q8MJ99|FOXP2_GORGO Forkhead box protein P2 OS=Gorilla gorilla gorilla GN=FOXP2 PE=2 SV=1 196 297 1.0E-16
sp|Q8MJ97|FOXP2_MACMU Forkhead box protein P2 OS=Macaca mulatta GN=FOXP2 PE=2 SV=1 196 297 1.0E-16
sp|Q8MJA0|FOXP2_PANTR Forkhead box protein P2 OS=Pan troglodytes GN=FOXP2 PE=2 SV=1 196 297 1.0E-16
sp|Q8HZ00|FOXP2_PANPA Forkhead box protein P2 OS=Pan paniscus GN=FOXP2 PE=2 SV=1 196 297 1.0E-16
sp|P0CF24|FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus GN=Foxp2 PE=3 SV=1 196 297 1.0E-16
sp|Q4VYS1|FOXP2_XENLA Forkhead box protein P2 OS=Xenopus laevis GN=foxp2 PE=2 SV=1 196 297 1.0E-16
sp|P58463|FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus GN=Foxp2 PE=1 SV=2 196 297 1.0E-16
sp|Q3BJS3|FOXN3_XENLA Forkhead box protein N3 OS=Xenopus laevis GN=foxn3 PE=2 SV=1 176 274 1.0E-16
sp|Q2LE08|FXP1B_DANRE Forkhead box protein P1-B OS=Danio rerio GN=foxp1b PE=2 SV=1 196 284 2.0E-16
sp|Q9DBY0|FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus GN=Foxp4 PE=1 SV=1 196 273 2.0E-16
sp|P32314|FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens GN=FOXN2 PE=1 SV=3 196 274 2.0E-16
sp|Q9BZS1|FOXP3_HUMAN Forkhead box protein P3 OS=Homo sapiens GN=FOXP3 PE=1 SV=1 196 289 3.0E-16
sp|Q6U8D7|FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis GN=FOXP3 PE=2 SV=1 196 289 3.0E-16
sp|Q28F43|FOXN2_XENTR Forkhead box protein N2 OS=Xenopus tropicalis GN=foxn2 PE=2 SV=1 188 274 2.0E-15
sp|Q66J77|FOXN2_XENLA Forkhead box protein N2 OS=Xenopus laevis GN=foxn2 PE=2 SV=1 188 274 3.0E-15
sp|O16850|FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans GN=daf-16 PE=1 SV=3 200 274 5.0E-15
sp|Q9I9E1|FOXH1_DANRE Forkhead box protein H1 OS=Danio rerio GN=foxh1 PE=1 SV=1 196 305 2.0E-14
sp|P98177|FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens GN=FOXO4 PE=1 SV=5 199 274 2.0E-14
sp|Q9WVH3|FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus GN=Foxo4 PE=1 SV=1 199 274 3.0E-14
sp|O43524|FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens GN=FOXO3 PE=1 SV=1 200 274 4.0E-14
sp|Q5W1J6|FOXM1_XENLA Forkhead box protein M1 OS=Xenopus laevis GN=foxm1 PE=2 SV=1 165 274 4.0E-14
sp|Q70KY4|FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus GN=Foxo6 PE=1 SV=1 200 288 4.0E-14
sp|Q9WVH4|FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus GN=Foxo3 PE=1 SV=1 200 274 5.0E-14
sp|A8MYZ6|FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens GN=FOXO6 PE=1 SV=1 200 288 5.0E-14
sp|Q66JJ0|FOXO1_XENTR Forkhead box protein O1 OS=Xenopus tropicalis GN=foxo1 PE=2 SV=1 200 274 1.0E-13
sp|A3RK74|FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio GN=foxo1a PE=2 SV=1 200 274 1.0E-13
sp|Q6EUW2|FOXO1_XENLA Forkhead box protein O1 OS=Xenopus laevis GN=foxo1 PE=2 SV=1 200 274 1.0E-13
sp|B4KBF6|FOXO_DROMO Forkhead box protein O OS=Drosophila mojavensis GN=foxo PE=3 SV=1 200 294 1.0E-13
sp|B4MB78|FOXO_DROVI Forkhead box protein O OS=Drosophila virilis GN=foxo PE=3 SV=1 200 294 2.0E-13
sp|E1BPQ1|FOXO1_BOVIN Forkhead box protein O1 OS=Bos taurus GN=FOXO1 PE=3 SV=2 200 274 3.0E-13
sp|B4JSC2|FOXO_DROGR Forkhead box protein O OS=Drosophila grimshawi GN=foxo PE=3 SV=1 200 294 3.0E-13
sp|Q6EUW1|FOXO3_XENLA Forkhead box protein O3 OS=Xenopus laevis GN=foxo3 PE=2 SV=1 200 274 3.0E-13
sp|A3RK75|FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio GN=foxo1b PE=2 SV=1 200 274 3.0E-13
sp|A4L7N3|FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa GN=FOXO1 PE=2 SV=1 200 274 3.0E-13
sp|Q9R1E0|FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus GN=Foxo1 PE=1 SV=2 200 274 4.0E-13
sp|Q810W5|FOXO1_ICTTR Forkhead box protein O1 OS=Ictidomys tridecemlineatus GN=FOXO1 PE=1 SV=1 200 274 4.0E-13
sp|G3V7R4|FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus GN=Foxo1 PE=1 SV=1 200 274 4.0E-13
sp|Q12778|FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens GN=FOXO1 PE=1 SV=2 200 274 4.0E-13
sp|B3P0K6|FOXO_DROER Forkhead box protein O OS=Drosophila erecta GN=foxo PE=3 SV=2 200 294 9.0E-13
sp|B4PTD3|FOXO_DROYA Forkhead box protein O OS=Drosophila yakuba GN=foxo PE=3 SV=2 200 294 9.0E-13
sp|Q08050|FOXM1_HUMAN Forkhead box protein M1 OS=Homo sapiens GN=FOXM1 PE=1 SV=3 195 349 9.0E-13
sp|P97691|FOXM1_RAT Forkhead box protein M1 OS=Rattus norvegicus GN=Foxm1 PE=2 SV=2 195 274 9.0E-13
sp|O08696|FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus GN=Foxm1 PE=1 SV=2 195 274 9.0E-13
sp|B4HF64|FOXO_DROSE Forkhead box protein O OS=Drosophila sechellia GN=foxo PE=3 SV=2 200 294 9.0E-13
sp|A2BGM5|FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio GN=foxn4 PE=1 SV=1 196 338 1.0E-12
sp|B3LYS5|FOXO_DROAN Forkhead box protein O OS=Drosophila ananassae GN=foxo PE=3 SV=2 200 294 1.0E-12
sp|Q95V55|FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster GN=foxo PE=1 SV=1 200 294 1.0E-12
sp|B4NFR1|FOXO_DROWI Forkhead box protein O OS=Drosophila willistoni GN=foxo PE=3 SV=1 200 294 1.0E-12
sp|B4G4S8|FOXO_DROPE Forkhead box protein O OS=Drosophila persimilis GN=foxo PE=3 SV=2 200 294 1.0E-12
sp|Q298W7|FOXO_DROPS Forkhead box protein O OS=Drosophila pseudoobscura pseudoobscura GN=foxo PE=3 SV=2 200 294 1.0E-12
sp|P70056|FOXH1_XENLA Forkhead box protein H1 OS=Xenopus laevis GN=foxh1 PE=1 SV=3 195 273 2.0E-12
sp|O15353|FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens GN=FOXN1 PE=2 SV=1 193 296 2.0E-12
sp|Q8JIT7|FAST3_XENLA Forkhead activin signal transducer 3 OS=Xenopus laevis GN=fast3 PE=1 SV=1 196 273 2.0E-12
sp|O75593|FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens GN=FOXH1 PE=1 SV=1 196 273 2.0E-12
sp|Q28GC4|FOXH1_XENTR Forkhead box protein H1 OS=Xenopus tropicalis GN=foxh1 PE=2 SV=1 196 273 5.0E-12
sp|Q61575|FOXN1_MOUSE Forkhead box protein N1 OS=Mus musculus GN=Foxn1 PE=1 SV=1 196 296 5.0E-12
sp|Q3BJS1|FOXN4_XENLA Forkhead box protein N4 OS=Xenopus laevis GN=foxn4 PE=2 SV=1 196 292 9.0E-12
sp|O88621|FOXH1_MOUSE Forkhead box protein H1 OS=Mus musculus GN=Foxh1 PE=1 SV=1 196 273 1.0E-11
sp|Q96NZ1|FOXN4_HUMAN Forkhead box protein N4 OS=Homo sapiens GN=FOXN4 PE=2 SV=2 196 351 2.0E-11
sp|Q8K3Q3|FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus GN=Foxn4 PE=1 SV=1 196 351 2.0E-11
sp|Q28H65|FOXN5_XENTR Forkhead box protein N5 OS=Xenopus tropicalis GN=foxn5 PE=2 SV=1 196 256 9.0E-08
sp|Q3UTB7|FOXR1_MOUSE Forkhead box protein R1 OS=Mus musculus GN=Foxr1 PE=2 SV=2 196 257 1.0E-07
sp|Q3BJS0|FOXN5_XENLA Forkhead box protein N5 OS=Xenopus laevis GN=foxn5 PE=2 SV=1 191 256 1.0E-07
sp|P39521|FHL1_YEAST Pre-rRNA-processing protein FHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FHL1 PE=1 SV=1 196 292 1.0E-07
sp|Q6PIV2|FOXR1_HUMAN Forkhead box protein R1 OS=Homo sapiens GN=FOXR1 PE=1 SV=2 196 314 2.0E-07
sp|Q3UM89|FOXR2_MOUSE Forkhead box protein R2 OS=Mus musculus GN=Foxr2 PE=2 SV=1 196 257 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:1901363 heterocyclic compound binding No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0003676 nucleic acid binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Forkhead

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|332
MAKPSSPFCGVPDAMSLYHDGFPMAAPMAAPMMAPMTAPMTSHAPMPDVTKPPRRPLSSSANVLHPPFNTANGSY
SPHKAHAPSPRSPLHHTVGSKLNMVSMAPPVANGPTTDSLHKRPHLTKFKTFAGKENVHPNVFPHQHHLSIENYN
HKPNKRGLMDAAPIKDSRPAKKSKTDDDPPLPPHDSFPPILDDGHKPPHSYANLIGMAILRSPNRRLTLAQIYKW
ISEHYSFYNPNDAGWQNSIRHNLSLHKNFIKIERPKDDPGKGNYWAIEPGTEFQFLKEKATRKSAPSAENIPVMS
TRLEPSKPAVTPSLEPKLPIAASRSTMPTSVSLPATPMLPQQLPPPQQLQPPPPQPQQQQQPSSGLPPLPVTQQP
PVDVSSDATIPVSDNAASDEAADKAPDNELPAESSLYSPLPPNMHSSPPVAARNVERRSGTPPSDVRNPASSVTR
SHKRRFASMDDSGYISSLDSSVMRPNNAKAALLLTSEADRPRIKRGRAEEEIARLRGSSPFSPTKSRSLFGLGPV
SSSPLRQTSDNQMLPPLTPLVKMNPPVRPPPSVSPNTNLRLHRDKVRNMLQSPLRRVAGVGDDCIPWSPAFNLDD
ALYAFDDASGSTEFDIFQDMPAMGEGAYPGMSPLDTGSPVKRHIKRSRAAATDSAKKKSLTSAPLLKVHEQSPSQ
FLETPSKAFEGLGSPSRLFGGSPLRNMTPSRFSTSLDLPADCDWPGFGIDSQDFMGHDDAGIAEFPGLDILQGFE
KIGSGAAANKESKAGKGPMGRTYQAW*
Coding >Ophun1|332
ATGGCCAAACCATCATCGCCCTTCTGCGGTGTCCCAGATGCCATGTCCCTCTATCACGATGGCTTCCCCATGGCG
GCTCCCATGGCGGCTCCCATGATGGCTCCCATGACGGCGCCAATGACCAGTCACGCCCCAATGCCCGACGTCACC
AAGCCTCCCCGTCGTCCGCTCAGCAGCTCGGCAAACGTTCTTCATCCGCCCTTCAACACCGCCAACGGCAGCTAT
TCACCGCACAAGGCCCACGCGCCTTCTCCGCGTTCGCCTCTTCACCACACTGTCGGCAGCAAGCTCAACATGGTG
TCCATGGCGCCTCCTGTTGCCAACGGTCCCACGACGGATTCTCTGCACAAGAGACCCCATCTCACCAAATTCAAG
ACTTTTGCCGGAAAGGAAAACGTCCATCCCAACGTCTTTCCTCACCAACATCATCTGTCCATCGAAAACTACAAC
CACAAGCCCAACAAACGCGGCTTGATGGATGCCGCCCCCATCAAGGACTCGCGTCCGGCTAAAAAGTCCAAGACG
GACGACGACCCCCCGCTGCCCCCCCACGACTCCTTTCCTCCCATCTTGGACGATGGCCACAAACCGCCGCACAGC
TACGCCAACCTCATCGGCATGGCCATCCTTCGCTCCCCGAATCGCCGCCTGACCCTGGCCCAGATCTACAAGTGG
ATAAGCGAACACTACAGCTTCTACAACCCAAACGACGCTGGTTGGCAGAACAGCATCCGCCACAACCTGAGCCTG
CACAAGAACTTTATCAAGATCGAGCGCCCCAAGGACGACCCGGGCAAGGGCAACTACTGGGCCATCGAGCCGGGC
ACAGAATTTCAGTTCCTCAAAGAGAAGGCGACTCGCAAGTCGGCGCCCTCGGCCGAGAACATTCCCGTCATGTCG
ACGCGTCTGGAGCCCTCCAAGCCCGCCGTCACGCCCTCCCTGGAGCCGAAACTCCCGATTGCGGCCTCCCGGTCC
ACGATGCCGACCTCCGTCTCCCTGCCGGCCACGCCCATGCTTCCGCAGCAGCTACCGCCGCCCCAGCAGCTTCAA
CCGCCACCACCGCAGCCGCAGCAGCAGCAGCAGCCGTCGTCCGGCCTCCCTCCCCTGCCAGTCACCCAACAGCCG
CCCGTCGACGTGTCATCGGACGCCACCATCCCCGTCTCAGACAATGCCGCGTCCGATGAAGCGGCCGACAAGGCG
CCGGACAACGAACTCCCGGCCGAATCCTCGCTCTACTCGCCTCTTCCTCCCAACATGCATTCGTCGCCTCCCGTG
GCCGCCCGAAATGTCGAGAGGCGCAGCGGCACTCCGCCCTCAGATGTCCGCAACCCGGCCTCGTCGGTGACGCGA
TCTCACAAGCGCCGCTTCGCTTCGATGGACGACAGCGGCTACATCTCGTCGCTCGACTCGTCCGTCATGCGGCCC
AACAACGCAAAGGCCGCCCTCCTGCTCACCTCGGAGGCCGACCGACCGCGGATCAAGCGCGGACGCGCCGAAGAG
GAGATTGCTCGGCTCCGGGGCTCCTCGCCCTTTAGCCCTACAAAGTCGCGCTCACTCTTCGGCCTGGGTCCGGTC
TCATCGTCGCCTCTGCGGCAGACGAGCGACAACCAGATGCTGCCGCCCCTGACACCCCTCGTCAAGATGAATCCG
CCCGTGCGCCCGCCGCCGTCCGTATCCCCCAACACCAACCTGCGCCTCCACCGCGACAAGGTGCGCAACATGCTG
CAGTCGCCCCTCCGCCGGGTCGCAGGCGTCGGCGATGATTGCATTCCCTGGAGCCCCGCCTTCAACCTGGACGAC
GCGCTCTATGCCTTTGACGACGCGTCGGGCTCGACGGAATTCGACATCTTCCAAGACATGCCGGCCATGGGCGAA
GGCGCCTACCCTGGAATGAGCCCCCTCGACACGGGATCTCCAGTCAAGCGACACATCAAGCGGTCTCGGGCCGCA
GCCACGGACTCGGCCAAGAAGAAGTCTCTGACGTCGGCGCCGCTGCTCAAGGTGCATGAACAGTCGCCGTCGCAG
TTCTTGGAGACGCCGAGCAAGGCGTTTGAGGGTCTAGGGTCCCCCTCGAGGCTGTTTGGGGGCTCGCCGCTCCGA
AACATGACGCCCAGCAGGTTCTCGACGTCGCTCGACCTGCCCGCCGACTGCGACTGGCCGGGCTTCGGGATAGAT
TCCCAAGATTTCATGGGTCACGACGACGCCGGCATCGCCGAGTTCCCCGGCCTCGACATCTTGCAGGGGTTCGAG
AAGATTGGGTCGGGCGCGGCGGCCAACAAGGAGTCCAAGGCCGGCAAAGGGCCGATGGGGAGGACCTATCAGGCG
TGGTAG
Transcript >Ophun1|332
ATGGCCAAACCATCATCGCCCTTCTGCGGTGTCCCAGATGCCATGTCCCTCTATCACGATGGCTTCCCCATGGCG
GCTCCCATGGCGGCTCCCATGATGGCTCCCATGACGGCGCCAATGACCAGTCACGCCCCAATGCCCGACGTCACC
AAGCCTCCCCGTCGTCCGCTCAGCAGCTCGGCAAACGTTCTTCATCCGCCCTTCAACACCGCCAACGGCAGCTAT
TCACCGCACAAGGCCCACGCGCCTTCTCCGCGTTCGCCTCTTCACCACACTGTCGGCAGCAAGCTCAACATGGTG
TCCATGGCGCCTCCTGTTGCCAACGGTCCCACGACGGATTCTCTGCACAAGAGACCCCATCTCACCAAATTCAAG
ACTTTTGCCGGAAAGGAAAACGTCCATCCCAACGTCTTTCCTCACCAACATCATCTGTCCATCGAAAACTACAAC
CACAAGCCCAACAAACGCGGCTTGATGGATGCCGCCCCCATCAAGGACTCGCGTCCGGCTAAAAAGTCCAAGACG
GACGACGACCCCCCGCTGCCCCCCCACGACTCCTTTCCTCCCATCTTGGACGATGGCCACAAACCGCCGCACAGC
TACGCCAACCTCATCGGCATGGCCATCCTTCGCTCCCCGAATCGCCGCCTGACCCTGGCCCAGATCTACAAGTGG
ATAAGCGAACACTACAGCTTCTACAACCCAAACGACGCTGGTTGGCAGAACAGCATCCGCCACAACCTGAGCCTG
CACAAGAACTTTATCAAGATCGAGCGCCCCAAGGACGACCCGGGCAAGGGCAACTACTGGGCCATCGAGCCGGGC
ACAGAATTTCAGTTCCTCAAAGAGAAGGCGACTCGCAAGTCGGCGCCCTCGGCCGAGAACATTCCCGTCATGTCG
ACGCGTCTGGAGCCCTCCAAGCCCGCCGTCACGCCCTCCCTGGAGCCGAAACTCCCGATTGCGGCCTCCCGGTCC
ACGATGCCGACCTCCGTCTCCCTGCCGGCCACGCCCATGCTTCCGCAGCAGCTACCGCCGCCCCAGCAGCTTCAA
CCGCCACCACCGCAGCCGCAGCAGCAGCAGCAGCCGTCGTCCGGCCTCCCTCCCCTGCCAGTCACCCAACAGCCG
CCCGTCGACGTGTCATCGGACGCCACCATCCCCGTCTCAGACAATGCCGCGTCCGATGAAGCGGCCGACAAGGCG
CCGGACAACGAACTCCCGGCCGAATCCTCGCTCTACTCGCCTCTTCCTCCCAACATGCATTCGTCGCCTCCCGTG
GCCGCCCGAAATGTCGAGAGGCGCAGCGGCACTCCGCCCTCAGATGTCCGCAACCCGGCCTCGTCGGTGACGCGA
TCTCACAAGCGCCGCTTCGCTTCGATGGACGACAGCGGCTACATCTCGTCGCTCGACTCGTCCGTCATGCGGCCC
AACAACGCAAAGGCCGCCCTCCTGCTCACCTCGGAGGCCGACCGACCGCGGATCAAGCGCGGACGCGCCGAAGAG
GAGATTGCTCGGCTCCGGGGCTCCTCGCCCTTTAGCCCTACAAAGTCGCGCTCACTCTTCGGCCTGGGTCCGGTC
TCATCGTCGCCTCTGCGGCAGACGAGCGACAACCAGATGCTGCCGCCCCTGACACCCCTCGTCAAGATGAATCCG
CCCGTGCGCCCGCCGCCGTCCGTATCCCCCAACACCAACCTGCGCCTCCACCGCGACAAGGTGCGCAACATGCTG
CAGTCGCCCCTCCGCCGGGTCGCAGGCGTCGGCGATGATTGCATTCCCTGGAGCCCCGCCTTCAACCTGGACGAC
GCGCTCTATGCCTTTGACGACGCGTCGGGCTCGACGGAATTCGACATCTTCCAAGACATGCCGGCCATGGGCGAA
GGCGCCTACCCTGGAATGAGCCCCCTCGACACGGGATCTCCAGTCAAGCGACACATCAAGCGGTCTCGGGCCGCA
GCCACGGACTCGGCCAAGAAGAAGTCTCTGACGTCGGCGCCGCTGCTCAAGGTGCATGAACAGTCGCCGTCGCAG
TTCTTGGAGACGCCGAGCAAGGCGTTTGAGGGTCTAGGGTCCCCCTCGAGGCTGTTTGGGGGCTCGCCGCTCCGA
AACATGACGCCCAGCAGGTTCTCGACGTCGCTCGACCTGCCCGCCGACTGCGACTGGCCGGGCTTCGGGATAGAT
TCCCAAGATTTCATGGGTCACGACGACGCCGGCATCGCCGAGTTCCCCGGCCTCGACATCTTGCAGGGGTTCGAG
AAGATTGGGTCGGGCGCGGCGGCCAACAAGGAGTCCAAGGCCGGCAAAGGGCCGATGGGGAGGACCTATCAGGCG
TGGTAG
Gene >Ophun1|332
ATGGCCAAACCATCATCGCCCTTCTGCGGTGTCCCAGATGCCATGTCCCTCTATCACGATGGCTTCCCCATGGCG
GCTCCCATGGCGGCTCCCATGATGGCTCCCATGACGGCGCCAATGACCAGTCACGCCCCAATGCCCGACGTCACC
AAGCCTCCCCGTCGTCCGCTCAGCAGCTCGGCAAACGTTCTTCATCCGCCCTTCAACACCGCCAACGGCAGCTAT
TCACCGCACAAGGCCCACGCGCCTTCTCCGCGTTCGCCTCTTCACCACACTGTCGGCAGCAAGCTCAACATGGTG
TCCATGGCGCCTCCTGTTGCCAACGGTCCCACGACGGATTCTCTGCACAAGAGACCCCATCTCACCAAATTCAAG
ACTTTTGCCGGAAAGGAAAACGTCCATCCCAACGTCTTTCCTCACCAACATCATCTGTCCATCGAAAACTACAAC
CACAAGCCCAACAAACGCGGCTTGATGGATGCCGCCCCCATCAAGGACTCGCGTCCGGCTAAAAAGTCCAAGACG
GACGACGACCCCCCGCTGCCCCCCCACGACTCCTTTCCTCCCATCTTGGACGATGGCCACAAACCGCCGCACAGC
TACGCCAACCTCATCGGCATGGCCATCCTTCGCTCCCCGAATCGCCGCCTGACCCTGGCCCAGATCTACAAGTGG
ATAAGCGAACACTACAGCTTCTACAACCCAAACGACGCTGGTTGGCAGAACAGCATCCGCCACAACCTGAGCCTG
CACAAGAACTTTATCAAGATCGAGCGCCCCAAGGACGACCCGGGCAAGGGCAACTACTGGGCCATCGAGCCGGGC
ACAGAATTTCAGTTCCTCAAAGAGAAGGCGACTCGCAAGTCGGCGCCCTCGGCCGAGAACATTCCCGTCATGTCG
ACGCGTCTGGAGCCCTCCAAGCCCGCCGTCACGCCCTCCCTGGAGCCGAAACTCCCGATTGCGGCCTCCCGGTCC
ACGATGCCGACCTCCGTCTCCCTGCCGGCCACGCCCATGCTTCCGCAGCAGCTACCGCCGCCCCAGCAGCTTCAA
CCGCCACCACCGCAGCCGCAGCAGCAGCAGCAGCCGTCGTCCGGCCTCCCTCCCCTGCCAGTCACCCAACAGCCG
CCCGTCGACGTGTCATCGGACGCCACCATCCCCGTCTCAGACAATGCCGCGTCCGATGAAGCGGCCGACAAGGCG
CCGGACAACGAACTCCCGGCCGAATCCTCGCTCTACTCGCCTCTTCCTCCCAACATGCATTCGTCGCCTCCCGTG
GCCGCCCGAAATGTCGAGAGGCGCAGCGGCACTCCGCCCTCAGATGTCCGCAACCCGGCCTCGTCGGTGACGCGA
TCTCACAAGCGCCGCTTCGCTTCGATGGACGACAGCGGCTACATCTCGTCGCTCGACTCGTCCGTCATGCGGCCC
AACAACGCAAAGGCCGCCCTCCTGCTCACCTCGGAGGCCGACCGACCGCGGATCAAGCGCGGACGCGCCGAAGAG
GAGATTGCTCGGCTCCGGGGCTCCTCGCCCTTTAGCCCTACAAAGTCGCGCTCACTCTTCGGCCTGGGTCCGGTC
TCATCGTCGCCTCTGCGGCAGACGAGCGACAACCAGATGCTGCCGCCCCTGACACCCCTCGTCAAGATGAATCCG
CCCGTGCGCCCGCCGCCGTCCGTATCCCCCAACACCAACCTGCGCCTCCACCGCGACAAGGTGCGCAACATGCTG
CAGTCGCCCCTCCGCCGGGTCGCAGGCGTCGGCGATGATTGCATTCCCTGGAGCCCCGCCTTCAACCTGGACGAC
GCGCTCTATGCCTTTGACGACGCGTCGGGCTCGACGGAATTCGACATCTTCCAAGACATGCCGGCCATGGGCGAA
GGCGCCTACCCTGGAATGAGCCCCCTCGACACGGGATCTCCAGTCAAGCGACACATCAAGCGGTCTCGGGCCGCA
GCCACGGACTCGGCCAAGAAGAAGTCTCTGACGTCGGCGCCGCTGCTCAAGGTGCATGAACAGTCGCCGTCGCAG
TTCTTGGAGACGCCGAGCAAGGCGTTTGAGGGTCTAGGGTCCCCCTCGAGGCTGTTTGGGGGCTCGCCGCTCCGA
AACATGACGCCCAGCAGGTTCTCGACGTCGCTCGACCTGCCCGCCGACTGCGACTGGCCGGGCTTCGGGATAGAT
TCCCAAGATTTCATGGGTCACGACGACGCCGGCATCGCCGAGTTCCCCGGCCTCGACATCTTGCAGGGGTTCGAG
AAGATTGGGTCGGGCGCGGCGGCCAACAAGGAGTCCAAGGCCGGCAAAGGGCCGATGGGGAGGACCTATCAGGCG
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail