Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3318
Gene name
LocationContig_296:10700..22142
Strand+
Gene length (bp)11442
Transcript length (bp)10704
Coding sequence length (bp)10704
Protein length (aa) 3568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.7E-67 845 1231
PF00501 AMP-binding AMP-binding enzyme 1.4E-60 2566 2961
PF00668 Condensation Condensation domain 4.0E-15 364 563
PF00668 Condensation Condensation domain 3.6E-18 1474 1621
PF00668 Condensation Condensation domain 1.3E-09 1728 1892
PF00668 Condensation Condensation domain 2.5E-15 2079 2313
PF00668 Condensation Condensation domain 9.0E-25 3204 3508
PF00550 PP-binding Phosphopantetheine attachment site 3.7E-06 1381 1443
PF00550 PP-binding Phosphopantetheine attachment site 2.8E-09 3099 3161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 582 2257 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 754 2336 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 642 2314 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 648 2254 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 802 2259 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 582 2257 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 754 2336 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 642 2314 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 648 2254 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 802 2259 0.0E+00
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2528 3527 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2187 3521 6.0E-160
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 794 1998 7.0E-155
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2285 3546 7.0E-148
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2545 3499 1.0E-132
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2557 3538 2.0E-132
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2557 3520 2.0E-130
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2542 3538 7.0E-130
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2557 3520 7.0E-130
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2476 3563 5.0E-125
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 815 1619 2.0E-123
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2322 3508 5.0E-115
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2529 3499 3.0E-114
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2316 3519 2.0E-113
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2330 3280 4.0E-113
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1401 2334 2.0E-110
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2316 3151 3.0E-107
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 584 1528 5.0E-107
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2556 3519 9.0E-107
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2331 3499 2.0E-106
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2331 3499 3.0E-106
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2366 3519 9.0E-105
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2316 3499 8.0E-103
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2331 3499 2.0E-101
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2480 3258 6.0E-101
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 650 1448 1.0E-100
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 650 1448 1.0E-100
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 598 2185 3.0E-100
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 650 1448 9.0E-100
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 830 1615 2.0E-99
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2330 3271 3.0E-99
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 830 1438 2.0E-98
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 830 1438 2.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 818 1998 4.0E-98
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 632 2037 3.0E-96
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2555 3541 3.0E-94
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 412 1640 2.0E-93
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2540 3179 4.0E-93
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 770 1443 2.0E-92
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 818 1998 1.0E-91
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 821 1920 9.0E-91
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 817 1921 1.0E-90
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 817 1921 1.0E-90
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 745 1921 2.0E-90
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2331 3493 4.0E-90
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 752 2012 2.0E-89
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 830 1998 2.0E-89
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 829 1443 9.0E-89
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 758 1961 2.0E-88
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 774 1445 5.0E-88
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 591 1919 3.0E-87
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 752 1614 1.0E-86
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 818 1887 1.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 801 1481 2.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 593 1540 3.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 828 1614 3.0E-86
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 831 1961 8.0E-86
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 625 1998 9.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 814 1615 4.0E-85
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 768 1615 2.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 828 1994 3.0E-84
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 822 1789 5.0E-84
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 651 1443 1.0E-83
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 820 1892 9.0E-83
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 648 1644 7.0E-82
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 820 1883 4.0E-81
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 832 1868 7.0E-81
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 598 1921 4.0E-80
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2251 3287 2.0E-79
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2528 3173 2.0E-77
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2379 3469 4.0E-77
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 765 1868 7.0E-76
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 592 1663 1.0E-75
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2331 3536 1.0E-75
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2558 3519 3.0E-75
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 642 1612 7.0E-75
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2367 3493 7.0E-75
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 828 1896 2.0E-74
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 554 1824 6.0E-72
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 592 1443 2.0E-71
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2316 3065 8.0E-71
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 616 1603 2.0E-70
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 765 1923 3.0E-70
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2316 3524 7.0E-70
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2316 3341 1.0E-69
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 626 1603 2.0E-69
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2557 3524 3.0E-69
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2327 3548 4.0E-69
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2370 3379 6.0E-69
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2306 3379 9.0E-69
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 578 1687 3.0E-68
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2316 3530 5.0E-67
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2555 3521 1.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 575 1636 2.0E-66
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2327 3497 2.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2325 3465 7.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2471 3493 8.0E-66
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2324 3485 9.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2530 3521 2.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2511 3171 3.0E-65
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 823 1640 3.0E-65
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2325 3553 3.0E-65
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2375 3465 5.0E-65
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2552 3169 6.0E-65
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 845 1791 9.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 749 1614 2.0E-64
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2504 3338 3.0E-64
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 592 1603 4.0E-64
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2539 3273 4.0E-64
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2548 3338 1.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2527 3162 2.0E-63
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2563 3338 2.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 582 1643 2.0E-63
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 582 1634 8.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2549 3465 8.0E-63
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2375 3338 4.0E-62
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 827 1825 5.0E-62
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 827 1825 7.0E-62
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2546 3519 1.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 651 1622 2.0E-61
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2474 3270 2.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2300 3526 3.0E-61
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2474 3155 8.0E-61
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2545 3161 9.0E-61
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 781 1626 1.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2514 3333 1.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2538 3368 2.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 554 1616 3.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 844 1828 3.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2549 3163 7.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2549 3163 8.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 561 1614 9.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 598 1613 9.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2557 3169 1.0E-59
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2509 3338 1.0E-59
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 762 1443 1.0E-59
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2375 3535 2.0E-59
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2330 3163 6.0E-59
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2550 3167 7.0E-59
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2550 3175 7.0E-59
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2555 3499 7.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2474 3387 8.0E-59
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 592 1443 1.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2474 3174 1.0E-58
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 649 1603 1.0E-58
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2558 3338 1.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 831 1619 2.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2375 3210 3.0E-58
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 754 1641 7.0E-58
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2538 3368 7.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2478 3339 9.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2538 3368 1.0E-57
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 592 1619 2.0E-57
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2560 3518 2.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 641 1634 2.0E-57
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2478 3465 2.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 754 1641 3.0E-57
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 629 1603 4.0E-57
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 641 1634 4.0E-57
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 758 1347 5.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 632 1643 5.0E-57
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2328 3166 6.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 761 1450 7.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2555 3172 9.0E-57
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 628 1439 9.0E-57
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 804 1614 1.0E-56
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2540 3167 2.0E-56
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 592 1443 2.0E-56
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2516 3531 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 818 1616 3.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 766 1643 3.0E-56
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 761 1450 3.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2284 3171 4.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2549 3159 1.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2299 3501 1.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 825 1603 2.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2558 3170 2.0E-55
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2549 3338 2.0E-55
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 830 1779 3.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 592 1528 5.0E-55
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 605 1606 7.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2549 3258 9.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2556 3520 9.0E-55
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2555 3492 1.0E-54
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2477 3372 1.0E-54
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2547 3338 2.0E-54
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2549 3338 2.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2558 3338 2.0E-54
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 631 1616 3.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 766 1643 7.0E-54
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2542 3378 7.0E-54
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 629 1473 9.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2327 3493 1.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2542 3378 1.0E-53
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2548 3162 2.0E-53
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 804 1541 3.0E-53
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2558 3237 4.0E-53
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2529 3163 6.0E-53
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2566 3159 6.0E-53
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2555 3178 6.0E-53
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 770 1443 1.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 828 1634 2.0E-52
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2378 3482 2.0E-52
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2555 3507 4.0E-52
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2559 3484 6.0E-52
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 802 1448 6.0E-52
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 629 1443 1.0E-50
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2554 3159 1.0E-50
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2550 3163 2.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 583 1614 2.0E-50
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2560 3159 2.0E-50
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2549 3135 2.0E-50
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 804 1636 4.0E-50
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2871 3516 5.0E-50
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2549 3135 5.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 822 1462 6.0E-50
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 631 1616 8.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 577 1616 9.0E-50
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2542 3168 9.0E-50
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 569 1616 1.0E-49
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 809 1619 2.0E-49
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2559 3183 2.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 768 1612 2.0E-49
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 832 1614 3.0E-49
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 799 1616 3.0E-49
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 582 1614 4.0E-49
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2581 3482 4.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2557 3338 5.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2325 3159 5.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2532 3163 8.0E-49
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2330 3162 8.0E-49
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2557 3333 1.0E-48
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2375 3171 1.0E-48
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2477 3337 1.0E-48
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 821 1241 2.0E-48
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2584 3496 3.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 752 1619 4.0E-48
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2561 3169 2.0E-47
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 828 1443 2.0E-47
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1517 1898 3.0E-47
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 591 1615 9.0E-47
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2584 3466 4.0E-46
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 673 1615 6.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2526 3480 7.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2585 3499 7.0E-46
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 781 1615 9.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2558 3266 1.0E-45
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 806 1645 2.0E-45
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2701 3499 2.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 590 1443 2.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 806 1645 1.0E-44
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 828 1247 3.0E-43
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2572 3519 3.0E-43
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 626 1443 8.0E-43
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 852 1625 8.0E-43
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 732 1609 1.0E-42
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 639 1542 3.0E-42
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 752 1443 3.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2548 2996 3.0E-42
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2572 3156 4.0E-42
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2576 3151 1.0E-41
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2576 3151 1.0E-41
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 649 1543 6.0E-41
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 835 1345 6.0E-41
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 835 1345 6.0E-41
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 835 1345 6.0E-41
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 835 1345 6.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 835 1345 6.0E-41
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 854 1345 8.0E-41
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 854 1345 8.0E-41
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 835 1345 1.0E-40
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 835 1345 1.0E-40
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 835 1345 1.0E-40
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 835 1345 2.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 835 1345 4.0E-40
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 854 1615 2.0E-39
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 835 1345 3.0E-39
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2509 3064 3.0E-39
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 835 1345 3.0E-39
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 833 1614 5.0E-39
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 835 1345 5.0E-39
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1297 1949 7.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2555 3165 7.0E-38
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2584 3529 1.0E-37
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 841 1637 3.0E-37
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2375 3338 3.0E-37
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2562 3064 3.0E-37
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2562 3064 3.0E-37
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2562 3065 6.0E-37
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2562 3064 7.0E-37
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2562 3064 7.0E-37
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2562 3064 7.0E-37
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2562 3064 7.0E-37
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1916 2303 8.0E-37
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2562 3064 8.0E-37
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2562 3064 8.0E-37
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2562 3064 8.0E-37
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2562 3064 8.0E-37
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2562 3064 1.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2562 3064 1.0E-36
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2562 3064 1.0E-36
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2562 3064 2.0E-36
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2562 3064 2.0E-36
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 641 1528 3.0E-36
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2486 3142 3.0E-36
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2486 3142 3.0E-36
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2568 3064 3.0E-36
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2568 3064 5.0E-36
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2568 3064 5.0E-36
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2568 3064 5.0E-36
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2568 3064 5.0E-36
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2568 3064 5.0E-36
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2568 3064 5.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2491 3155 6.0E-36
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 858 1473 7.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2562 3064 7.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 854 1345 9.0E-36
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2568 3064 1.0E-35
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 855 1445 2.0E-35
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2547 3138 3.0E-35
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2547 3138 3.0E-35
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2547 3138 3.0E-35
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2562 3064 4.0E-35
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2542 3135 8.0E-35
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 850 1345 9.0E-35
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 857 1443 9.0E-35
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 751 1348 1.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2559 3150 2.0E-34
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2542 3135 2.0E-34
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 825 1631 7.0E-34
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2550 3135 8.0E-34
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2559 3156 2.0E-33
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 822 1443 3.0E-33
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2383 3160 4.0E-33
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 822 1443 4.0E-33
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 822 1443 5.0E-33
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 848 1443 5.0E-33
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 850 1345 5.0E-33
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 841 1348 1.0E-32
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 790 1351 2.0E-32
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 845 1445 2.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 828 1445 4.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 850 1345 5.0E-32
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2555 3062 5.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 850 1347 6.0E-32
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 841 1348 6.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 850 1345 7.0E-32
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2559 3162 8.0E-32
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2559 3216 9.0E-32
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 835 1347 1.0E-31
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 807 1539 2.0E-31
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 819 1457 2.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2618 3066 3.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2618 3066 3.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2618 3066 7.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2564 3064 7.0E-31
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 837 1347 2.0E-30
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 837 1347 2.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2618 3066 2.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 850 1345 5.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2562 3064 5.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2562 3064 6.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2549 3064 1.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 843 1348 2.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2562 3064 2.0E-29
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 845 1345 2.0E-29
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2621 3066 2.0E-29
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2618 3066 3.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2585 3064 3.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 843 1348 8.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 843 1348 8.0E-29
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2584 3064 8.0E-29
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 834 1443 9.0E-29
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 834 1443 1.0E-28
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 843 1348 1.0E-28
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2621 3066 1.0E-28
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2549 3064 1.0E-28
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2549 3064 1.0E-28
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2549 3064 1.0E-28
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2549 3064 1.0E-28
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 856 1538 2.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 845 1443 2.0E-28
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 856 1443 2.0E-28
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 820 1494 3.0E-28
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2585 3206 3.0E-28
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 820 1494 4.0E-28
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 845 1494 4.0E-28
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2566 3064 4.0E-28
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 614 1443 5.0E-28
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2585 3066 5.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 845 1341 5.0E-28
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 900 1245 6.0E-28
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 858 1341 1.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 845 1345 2.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 851 1603 4.0E-27
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2559 3159 4.0E-27
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2549 3064 4.0E-27
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2549 3064 4.0E-27
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 845 1347 5.0E-27
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2703 3064 8.0E-27
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2703 3064 8.0E-27
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2703 3064 8.0E-27
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2703 3064 8.0E-27
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2703 3064 8.0E-27
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2555 2987 9.0E-27
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2703 3064 9.0E-27
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 845 1345 1.0E-26
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2560 3064 1.0E-26
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2560 3064 1.0E-26
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2560 3064 1.0E-26
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2703 3064 1.0E-26
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2703 3064 1.0E-26
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2703 3064 1.0E-26
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2703 3064 1.0E-26
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2703 3064 2.0E-26
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2703 3064 4.0E-26
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 835 1341 8.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1918 2261 1.0E-25
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 858 1341 2.0E-25
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 858 1341 2.0E-25
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 858 1341 4.0E-25
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2583 3135 7.0E-25
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2560 3064 1.0E-24
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 877 1539 1.0E-24
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 886 1347 2.0E-24
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 858 1341 2.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 858 1341 2.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 858 1341 2.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 858 1341 2.0E-23
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 858 1341 2.0E-23
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2562 3064 2.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 858 1341 3.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 858 1341 4.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 858 1341 4.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 858 1341 4.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 858 1341 4.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 858 1341 4.0E-23
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2610 3151 8.0E-23
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2550 2976 2.0E-22
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2546 3151 3.0E-22
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 858 1341 3.0E-22
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 858 1341 3.0E-22
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1137 1455 4.0E-22
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 845 1351 4.0E-22
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 858 1341 6.0E-22
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 858 1341 6.0E-22
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 858 1341 6.0E-22
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 858 1341 6.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3040 3488 2.0E-21
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 858 1341 4.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 883 1416 5.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 830 1265 2.0E-19
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3196 3530 3.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 389 564 1.0E-18
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3199 3520 1.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3221 3499 1.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2627 2972 1.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2077 2298 2.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3096 3499 2.0E-17
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 43 323 5.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2589 3065 8.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 356 567 1.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3109 3521 2.0E-16
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3194 3520 3.0E-16
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3194 3560 4.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3182 3518 5.0E-16
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2584 3067 5.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3094 3542 6.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3114 3560 1.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 387 506 2.0E-15
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3021 3333 5.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 19 326 6.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3198 3529 9.0E-15
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2062 2346 2.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3201 3520 3.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 379 506 4.0E-14
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 392 565 6.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 160 323 6.0E-14
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3196 3520 6.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 846 1360 6.0E-14
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3201 3511 7.0E-14
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2558 3133 7.0E-14
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3193 3527 1.0E-13
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2563 3064 1.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3299 3503 2.0E-13
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 846 1245 2.0E-13
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3197 3492 3.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 857 1351 4.0E-13
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3201 3510 5.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 972 1439 5.0E-13
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3196 3504 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 378 502 2.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2701 3062 3.0E-12
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 839 1416 3.0E-12
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 968 1245 3.0E-12
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3199 3466 4.0E-12
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3200 3491 4.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3193 3504 5.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3204 3503 6.0E-12
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2589 2971 6.0E-12
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 856 1348 7.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2077 2307 1.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 877 1348 1.0E-11
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2558 3067 1.0E-11
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3201 3469 2.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2583 2987 2.0E-11
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2706 3135 2.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 857 1242 2.0E-11
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 857 1242 2.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1881 2214 5.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 392 491 5.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3193 3490 5.0E-11
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2564 3065 6.0E-11
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3193 3490 7.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 214 369 1.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 857 1245 1.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 930 1347 2.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 246 364 3.0E-10
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3196 3501 4.0E-10
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2562 3065 4.0E-10
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 855 1346 4.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 828 1241 4.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 23 370 5.0E-10
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 381 500 5.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3201 3466 6.0E-10
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3195 3522 7.0E-10
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3193 3499 1.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2564 3064 1.0E-09
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2560 3061 1.0E-09
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2560 3061 1.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2607 2971 2.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 862 1242 2.0E-09
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2567 3065 2.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 163 323 3.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 976 1246 5.0E-09
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 857 1247 5.0E-09
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 856 1348 6.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2703 3065 7.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2703 3065 7.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2564 3065 8.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 379 504 1.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 398 551 1.0E-08
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 398 551 1.0E-08
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2546 2971 1.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 837 1345 1.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2709 3072 2.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2681 3067 2.0E-08
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2574 3064 3.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 968 1296 3.0E-08
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 2584 3087 4.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 815 1244 4.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 385 500 5.0E-08
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 832 989 5.0E-08
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 847 1245 5.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 378 476 9.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 392 500 1.0E-07
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2703 3065 1.0E-07
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2576 3065 1.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 2580 3067 1.0E-07
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2701 3066 1.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 255 516 2.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2128 2221 2.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 908 1220 2.0E-07
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 847 1245 2.0E-07
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 857 1348 2.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2701 3066 2.0E-07
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2701 3066 2.0E-07
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 854 1348 2.0E-07
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2703 3066 2.0E-07
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 2580 3067 2.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3069 3499 3.0E-07
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 2580 3067 3.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2702 3065 3.0E-07
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 2703 3090 3.0E-07
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2702 3065 3.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 398 538 4.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3185 3496 4.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2113 2262 4.0E-07
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2708 3064 4.0E-07
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2563 3065 5.0E-07
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2563 3065 5.0E-07
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 2580 3067 5.0E-07
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 393 507 6.0E-07
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2703 3065 6.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 379 484 7.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2701 3067 7.0E-07
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 2580 3067 7.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 378 500 8.0E-07
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 2580 3067 8.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3201 3520 9.0E-07
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 398 452 1.0E-06
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 2584 3081 1.0E-06
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 965 1241 1.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3023 3163 2.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 379 549 2.0E-06
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 2703 3067 2.0E-06
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2703 3065 2.0E-06
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 2575 3087 2.0E-06
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 951 1241 2.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 846 1245 2.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2687 3067 2.0E-06
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 832 989 2.0E-06
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 832 989 2.0E-06
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 832 989 2.0E-06
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 2580 3067 2.0E-06
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 2580 3067 2.0E-06
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2701 3066 2.0E-06
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 827 1241 3.0E-06
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2576 3065 3.0E-06
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2574 3066 3.0E-06
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2701 3066 3.0E-06
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2701 3066 3.0E-06
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 2570 3064 4.0E-06
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3023 3163 5.0E-06
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 2706 3087 5.0E-06
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2701 3066 5.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 404 495 6.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 380 500 6.0E-06
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2078 2289 6.0E-06
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2630 3072 6.0E-06
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2044 2232 8.0E-06
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 857 1348 9.0E-06
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2696 2971 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3318
MTLRKARVDGHVNGKTEVTIWGASLTYGQLQDLSADFASEECVEALDMKTSSLLLAESNKSLRTEPIEIVVGALV
YCFSRKFRHRCMPLVFVIGGRDQDQPLSDSRPVVIPIESTSTRLEAVMLAKDGMRAELATHGVLRSSKVGEQLGT
LTLATKSACGIIVMHVQASFRLGRVFILIQLGRKDEQELRLEDWARVFMDELVTTAEELQRAPPRLTLSDLPLLS
LSYHGLDSLLHQQLFGLRVDPGNVKDIFPCSPLQEGVLLSKSSYDISWIWNCVPPHGSDAISPARLQEAWKTAVR
RHDMFSTVFSMHPEEDSFIQIVMATPTARILQLHSTASPAGKLAALEKPVFRAEEPKHLLTILSPLSSDDTMEDV
PSSIALPAEALAGITGFCRRKKLTRSVFVHIAWALVLSYFTGADDVCFGYMASGRDIPVEGVDRVFGPLANTVIS
RIDLRTPLEKLMTETAAMLKEHRRHQQTSLAEIQRSLGVSGGRRLFNSLLSLLKATDTESLLFKKHSQFDLVLEG
YLEEGSISLCLHYRAKAVRRDVAEEVCVLLMRAIDYVVSTEGTNGVVNGIPDGRVSSRFFKHAVGADKHSTRAYW
QCRLGEVENLNLVFLKGPKTPSVRDADETITMRGLGRKHLCTTEMAARAAWSVIVAQASESDTALFGVSVTDGRQ
RLMGKGASVLPLAVSLDWSASVDSFMESLQKQTEDMARYEGVSLHWLRQIQHQAVDFQSLLVCHGRRDVVDSWNG
PFVLELRELDDETACLHISFDSRVVTRRRVVRIGQQFEYLVRELLNGNRGKEMLRNLRIIPPQHLDHVWAWNCTV
PEPVESSVQELIRARVLAMPRALAIDAWDGTLTFAQLDERSDALARRLVADGIGPGALVPLCFEKSMWMSVAMLG
VIKSGAAAVGLDPKQPEDRLREIIKAVRARLVLASSFKEHLARRVSRCPVLVVDSNLQDGNQPLPAVDPSEIVYA
VFTSGSTGKPKGVLVTQRSLSSAAVYQREAFGFGHGPRVLDFSSYCFDAAWFNLVLTLTSGGCLCVPSEKQLEGE
LEGCFERYDIGLAFLTPSVVRHLDVDALGRLDTLLIGGEIVLPSDVSGLSGYKTQVKIIYGPSECTPMTTRHDLT
EDGTISIGRGVGVCTWIVDQDHGQSLVPIGMIGELVLEGPLLGQGYIDEPEKTKASFIQDATWLLQGKGGVEGRH
GRIYRTGDLVRYDDDGNIVYVRRKDRQVKIRGQRVELAEVEQHVLELLQTGHTLDTTKAHVIAETMEAENSGSSM
LVSFVSIQGETEDGDEDGMKEQHAVLVQSLTRGLSKRLSDRVPAYMVPVAFIPVRIVPKTLTGKTNQARLREIGL
AWWKRCRAMMNDDEDEDGEGTRASTNMERMLQEVWMTVLNLPTRQLFSIDKAFTRLGGDSISAMQVVSKCRALKI
IVPSVSDVLEASTIRRLAPRCHFQKRPTQQDERGDELERDEAETMAAFSLSPMQQRLMDFFPDGINHFNQSFVLE
TKRELSVEGIVDALHAVVKRHGMLRARFHKDDKGVWEQSVVGARPDAFAFAYHAASSREEALEIGQQRQEKLDMV
NGPVFACDLIDLNDSQIVVLSAHHLVVDLVSWRLIWRDIQEHVQTGCLGGSHTASFRTWCRFQAEAARHLSPEAV
LPYPVPAADLSFWGVSPAENTGARCEDLSFALDLRDTELLLGYSNDGLRTEPLDILLGSFAYSFAEVFFERSSSL
PAIFVEGHGREQLEADGLDVSETVGWFTTMLPVAIDGKAATTVVEAIRLAKDTRRRVPGKGQPYFASRLYSRSCR
SVFRKHHDVELLVNFAGRYQQLESRDGLFRLVDASLRVVSASARRFALIEANMVVQNGRLSVTFTFNKDMKHQSR
LRSWFPCFMDTLTGAVRMLEGLSPRLTLSDVGLLSLSYRGLNRLLDEVLPELGLEAADVVDAYPASPMQEGILLS
GQTGSCSYATYWIWTCTANGGHEIVSPRRLETAWRGVVSQHAILSTVFAPHPEGSGFVQMVLAKPRIQVSQMSVT
TGTAAEALSRLERPEIGPASPLHAFTVCRGGADLVAAEVIRHIRGCSNFDKVSYWAAFLEGVRPCEVAVSFAASD
AAGDGFTYIPIPSESVRGVRAFCREMEVSRSAFLQVIWAMVLSQLVGLPEVCFGYLASGRGEAIDGIESIVGPLA
NMLYSRVDLRDSKAGVFRKTWVDSIEHLKYQHVSLARVQHAMDLSGRRLFNTAMSVREEDCFESDERSISLAYHS
HQDPHEYDLLLAGFFRRDGSMNLSIQFREATVSRQLAEEAAATLAKAIDYAMTRQKHEDSTLDVAFFRHVVGSSE
SETMAFWGDYLSDLDANYFPPLRKPSSKDGRLVLRAGTARFSFNRLDEYTVAEVVAAAWTVMAARKVGSSEALVG
VSSRGRELLLRVRLDWTVSGTELLQLVRRQLVQRPGFHVIRRASDEAALACNLQANLVIEERGSTTCMAPDAMET
IDYDVVVNCQVQGEEASLTVWFDGNSVSEPVARSAAAQLQHVLDWLSDDKRRESSIVEAIEATVEDLEQIWAWNT
PVPVPVERCVHDMIHQTAQMYPQAQAVCGWDGDLTYQQLDSLATALAHRLVAEGATRGCLVPLLFDKSAWMPVAM
LAVIKAGSAAVAMDTTQPEGRLRDILSQLDGGQVVVSSVANEHLARRLSRGREPIVVGRDALPRSTAIDKLPTVY
PSDTLYAVFTSGSTGSPKAALITHSNMSSAVVYQQEALELTRSSRVFDFASYAFDVAWDNFVHALTCGGCLCIPS
EAERLEDVEGAVVALRANYLHITPTLLRCLDWSKLGGVSVVVLSGEPVLAEDLAIVPDCVRMVNAYGPAETNVVT
VQKLDTRLPVSIGRGTGSCTWIVDVDRVSSLTPIGTAGELWIEGPLVGDGYLNDCRRTNEVFVDDPDWLLRGTAD
RPGRSGRLYRTGDLVRYNNDGTLLYLGRRDSQVKIRGQRVELGEVETRVRQALDSSVSAAVVAEMIQPEASPDSI
LVVFVSLQHVALSDDEHAQAVGRATAGIKEQLSERLPRFMIPTSYIPLSKIPLTATGKTDRRRLRAMGGLMTMRE
LAALSRKGVINQRRQPETESELLLLRLWAEVLDCSLESISADDGFIGVGGDSVGAMRLVSLARDRGFGLTVRDVF
QKPMLRDMSTCLKPLGKSSSLFIRPFSLLGSGEDEARCSAALLCGLNRDSVVDVLPCTPLQRSLFMREGEFMTRH
VLEICKHIDLDKFRTSWDQVVLRNAVMRTRIVEMKGEGYVQVVTDEPTLWMACKSLDECEKYAERNRMGCGTRLA
RLAVVESEGCAWLVWDMHWALYDGWALRLLLKEAEGIYYEKPCRPLGDTSALVRYVLDGNREETASFWRRQFTGL
TSLPFPPLSATNENPPQINSEVQHKLPPILTRSDEFTAATIIRAGLSLVIAWTLNQAHEAIFGATVSGRQADMNG
IERLAGPVFSTVPLRIPIDWHGTAGQLLSQVQSQAAEMVPYEQTGLDGIAGVSAEAEAAVGFRTLLVVQSAIKKG
DVRFRDEGAKVFARGLVAERHTIVELGLRSGAYPLYVEFNRF*
Coding >Ophun1|3318
ATGACTCTCCGAAAAGCCCGCGTCGACGGACATGTGAACGGCAAGACCGAAGTGACGATATGGGGCGCCTCCTTG
ACCTACGGACAGCTGCAGGATCTCTCAGCCGACTTTGCTTCGGAAGAGTGTGTCGAGGCCCTCGATATGAAGACT
AGTTCGCTGCTGCTGGCAGAGAGCAACAAGAGCCTGCGGACGGAACCGATTGAGATTGTTGTCGGCGCTCTCGTT
TACTGCTTCTCAAGAAAGTTCCGCCATCGTTGCATGCCGCTTGTCTTCGTGATCGGTGGCCGAGACCAAGACCAG
CCGCTGAGCGACTCACGTCCGGTCGTAATCCCTATCGAGAGCACCAGCACCCGACTTGAAGCCGTGATGCTAGCA
AAGGATGGCATGCGCGCGGAGCTGGCAACCCACGGGGTCTTAAGGAGCAGCAAAGTTGGGGAGCAGCTTGGGACG
TTGACGTTGGCGACCAAATCGGCTTGTGGGATTATTGTGATGCATGTCCAGGCGAGTTTCCGGCTGGGCCGAGTC
TTCATCCTGATACAGCTTGGTAGGAAAGACGAACAAGAGCTTCGGCTGGAGGATTGGGCCAGGGTCTTCATGGAC
GAGCTTGTGACAACTGCTGAGGAGCTACAGCGTGCGCCACCGAGGCTTACATTGTCTGACTTGCCCTTGCTCTCC
CTTTCTTACCACGGTCTCGATAGTCTGCTTCATCAGCAGCTCTTCGGTCTAAGAGTTGATCCAGGCAACGTGAAG
GATATATTCCCTTGCTCGCCGCTGCAGGAGGGCGTGCTTCTGAGCAAATCATCATACGACATTTCCTGGATATGG
AACTGCGTGCCTCCTCACGGCAGCGACGCCATCTCACCGGCTCGGCTGCAAGAGGCTTGGAAGACGGCTGTCCGT
CGGCACGATATGTTTTCTACCGTCTTCAGCATGCACCCGGAGGAGGACAGCTTCATACAGATTGTGATGGCTACG
CCGACGGCTCGGATCTTGCAGCTGCACTCGACTGCCTCCCCAGCTGGGAAACTGGCCGCGCTTGAAAAGCCGGTG
TTTAGAGCTGAAGAGCCTAAGCACCTCCTTACGATCTTGTCGCCTTTGAGCTCAGACGATACCATGGAGGATGTC
CCTAGCAGCATCGCTCTTCCGGCAGAGGCGCTGGCAGGTATCACGGGATTCTGCAGGAGAAAGAAGTTGACGCGG
TCTGTCTTCGTGCACATTGCTTGGGCCTTGGTTCTGTCTTACTTCACCGGCGCGGATGACGTCTGCTTTGGATAC
ATGGCTTCTGGTCGGGATATCCCGGTTGAAGGCGTGGATAGAGTCTTTGGTCCGTTGGCCAACACGGTCATCAGT
CGCATCGACCTGCGCACGCCCCTTGAGAAATTGATGACAGAGACGGCAGCAATGCTGAAGGAGCACAGGCGTCAC
CAGCAGACCTCGCTGGCCGAGATACAGCGAAGCCTGGGTGTATCTGGTGGTCGACGACTCTTCAACTCGCTGCTG
TCTCTCCTCAAGGCCACTGACACCGAGTCGCTTTTGTTTAAGAAGCATAGTCAGTTTGACTTGGTGCTCGAGGGC
TATCTCGAGGAGGGAAGCATCAGTCTTTGTCTCCACTACCGAGCCAAGGCTGTTCGTCGTGACGTGGCGGAGGAG
GTTTGCGTGTTGTTGATGCGTGCCATTGACTATGTCGTTTCGACAGAGGGAACAAATGGAGTCGTCAACGGGATC
CCAGACGGTCGTGTTTCGAGCCGGTTCTTTAAACACGCCGTTGGTGCAGACAAGCACTCGACAAGGGCATATTGG
CAGTGTCGCCTCGGTGAAGTGGAAAACCTTAACTTGGTCTTCTTGAAAGGGCCCAAGACTCCTTCGGTGAGGGAC
GCTGACGAGACAATCACGATGAGAGGCCTCGGACGAAAGCATCTCTGTACCACGGAGATGGCTGCAAGGGCGGCG
TGGTCCGTGATAGTGGCCCAAGCCAGCGAGTCGGACACGGCCTTATTTGGCGTATCGGTAACTGACGGACGGCAG
AGATTGATGGGTAAAGGGGCTTCAGTCTTGCCACTCGCCGTTTCTTTGGACTGGAGTGCCAGCGTCGACAGTTTC
ATGGAGTCGTTGCAGAAGCAGACTGAGGACATGGCGAGATACGAGGGCGTGAGTCTGCACTGGCTGCGTCAGATA
CAGCATCAAGCAGTCGACTTTCAGTCGCTGTTGGTTTGTCATGGCCGCCGAGACGTCGTGGACAGTTGGAACGGT
CCGTTTGTCTTGGAGCTTCGAGAGCTGGATGACGAGACGGCTTGTCTGCACATCAGCTTCGATTCCCGTGTCGTG
ACGAGAAGACGCGTTGTGCGGATTGGCCAACAGTTCGAGTACTTGGTGCGCGAGCTCCTAAACGGGAATAGGGGC
AAAGAGATGCTCCGAAACCTGCGCATCATCCCTCCACAACATCTCGACCACGTCTGGGCGTGGAACTGTACAGTT
CCCGAACCCGTCGAGTCGTCGGTTCAGGAGCTGATACGGGCTCGAGTGCTCGCTATGCCACGGGCTCTCGCTATC
GACGCCTGGGACGGTACTCTGACCTTTGCACAACTGGATGAGCGATCCGATGCGCTGGCTCGCCGACTCGTGGCC
GATGGTATTGGTCCAGGGGCCTTGGTGCCGCTGTGTTTCGAGAAGTCGATGTGGATGTCTGTTGCCATGCTGGGA
GTTATCAAGTCGGGAGCTGCGGCGGTGGGCTTGGATCCGAAGCAGCCGGAAGACCGGTTACGAGAAATCATCAAG
GCAGTACGCGCTCGACTCGTCTTGGCGTCGTCGTTCAAGGAGCATCTCGCGAGGAGGGTGAGTCGGTGCCCGGTT
CTGGTCGTCGACTCTAATCTTCAGGACGGGAACCAGCCGTTGCCGGCAGTCGATCCGTCCGAGATTGTCTACGCC
GTCTTCACGTCTGGGAGCACGGGAAAGCCAAAGGGCGTCTTGGTAACGCAGCGGAGCCTGAGCAGTGCAGCCGTC
TACCAGCGTGAGGCTTTCGGCTTCGGCCACGGTCCGCGGGTGCTGGACTTTTCGTCGTACTGTTTCGATGCAGCT
TGGTTCAATCTTGTGCTCACTTTGACGTCTGGAGGTTGTCTGTGCGTGCCGTCGGAGAAGCAGCTGGAGGGGGAG
CTCGAAGGGTGTTTCGAGAGATATGACATTGGGCTGGCTTTCTTGACGCCTTCTGTTGTCCGGCATCTTGATGTT
GATGCTCTTGGACGGCTTGATACGCTGCTGATTGGTGGTGAGATCGTGTTGCCGAGCGACGTGTCTGGCTTGTCT
GGCTATAAGACGCAGGTCAAGATTATCTATGGGCCCTCGGAGTGTACGCCCATGACGACCCGTCACGACTTGACG
GAAGACGGAACTATATCCATCGGCCGAGGAGTCGGTGTCTGCACCTGGATTGTCGATCAGGACCACGGCCAATCT
CTCGTACCAATCGGCATGATCGGCGAGCTCGTGCTGGAAGGGCCGCTGCTTGGACAAGGCTATATCGACGAGCCG
GAGAAGACGAAAGCCTCCTTTATACAGGATGCTACCTGGCTCCTACAAGGAAAAGGGGGGGTCGAGGGTCGGCAC
GGACGAATCTACCGGACAGGCGATCTGGTGCGGTACGACGACGACGGCAACATCGTTTATGTGAGGCGCAAAGAT
AGGCAGGTCAAGATCCGAGGACAGCGGGTGGAACTGGCTGAGGTCGAGCAGCACGTCTTGGAGCTTTTGCAGACC
GGTCATACCTTGGACACGACCAAGGCCCACGTCATAGCTGAGACGATGGAGGCAGAGAACAGCGGAAGCAGCATG
CTCGTCTCCTTTGTGTCTATACAAGGAGAGACAGAGGATGGTGATGAAGATGGAATGAAAGAACAGCATGCTGTC
CTCGTCCAAAGCTTGACCAGGGGCTTATCGAAACGGCTTTCTGATCGTGTACCGGCTTATATGGTGCCCGTGGCC
TTTATTCCCGTCAGGATTGTTCCGAAGACGTTGACCGGCAAGACGAATCAGGCTCGGCTTCGGGAAATTGGCCTA
GCCTGGTGGAAGCGGTGTCGTGCCATGATGAATGATGATGAAGATGAAGATGGCGAGGGAACTCGAGCATCGACT
AATATGGAGAGGATGCTTCAGGAGGTGTGGATGACGGTGCTCAATCTTCCAACTCGTCAACTCTTTTCCATCGAC
AAGGCCTTTACCAGGCTGGGAGGCGATTCCATCTCGGCTATGCAGGTCGTCTCCAAGTGCAGGGCCTTGAAGATT
ATTGTTCCGTCCGTCAGTGACGTCTTGGAAGCCAGCACGATCCGCAGGCTGGCGCCACGCTGCCACTTTCAGAAG
CGTCCGACTCAGCAAGATGAGAGAGGAGACGAGCTGGAAAGGGATGAAGCAGAGACGATGGCGGCTTTTTCTCTC
TCGCCGATGCAGCAGCGGTTGATGGACTTCTTTCCAGACGGCATCAACCACTTCAATCAAAGTTTCGTACTCGAA
ACGAAGAGGGAGCTTTCTGTTGAGGGAATCGTCGATGCTTTGCACGCGGTTGTCAAACGACACGGCATGCTTCGA
GCCCGGTTCCATAAGGACGACAAGGGAGTATGGGAGCAGTCTGTGGTAGGAGCCCGTCCAGATGCATTCGCTTTT
GCCTACCATGCAGCATCCAGCCGAGAAGAGGCGCTGGAAATCGGGCAGCAGAGACAGGAGAAGCTCGATATGGTC
AACGGCCCCGTCTTTGCCTGCGACTTGATTGACTTGAACGACAGTCAGATAGTCGTCCTCTCGGCTCACCACCTA
GTCGTCGACCTCGTCTCGTGGCGCCTCATCTGGAGGGATATTCAGGAGCACGTTCAGACGGGCTGTCTTGGTGGT
TCACATACAGCATCGTTTCGCACCTGGTGCAGGTTTCAGGCAGAGGCAGCCCGTCATCTGAGTCCCGAAGCTGTG
CTTCCGTACCCGGTGCCAGCGGCAGACTTGAGCTTCTGGGGCGTTTCTCCGGCTGAGAATACAGGTGCGAGATGT
GAGGACTTGTCGTTTGCTCTTGATTTGCGGGATACCGAGTTGCTGCTGGGCTACAGTAACGACGGATTGCGGACT
GAGCCCCTTGATATCCTGTTGGGTTCGTTTGCCTATTCTTTTGCCGAGGTTTTCTTCGAAAGAAGTTCTTCTCTT
CCGGCCATCTTCGTCGAGGGCCACGGCCGTGAACAGCTGGAGGCGGATGGGCTCGATGTCTCGGAGACGGTTGGA
TGGTTCACAACCATGTTACCTGTTGCCATCGACGGCAAGGCTGCAACGACAGTCGTTGAGGCGATTCGGTTGGCG
AAAGATACGAGACGCAGAGTTCCGGGAAAGGGACAGCCGTACTTTGCGTCACGACTCTACAGCCGCTCATGCCGT
TCGGTGTTTCGGAAGCACCATGATGTCGAGCTGCTCGTCAACTTTGCAGGGCGCTACCAGCAGTTGGAAAGCAGA
GATGGTCTGTTCCGGCTGGTGGATGCTTCCTTGCGAGTTGTCTCTGCCTCGGCCCGGCGATTTGCACTGATTGAA
GCCAACATGGTCGTCCAGAACGGGCGGCTCTCTGTCACCTTTACCTTTAACAAGGATATGAAGCATCAGTCGAGG
TTGAGGAGCTGGTTCCCTTGCTTCATGGATACGCTGACGGGGGCTGTGCGGATGCTTGAGGGATTGTCTCCGAGA
TTGACGCTCAGTGACGTCGGATTGCTATCGCTTTCGTACCGAGGGCTGAACCGCTTGTTGGACGAAGTGCTTCCT
GAGCTTGGGCTTGAGGCTGCTGATGTGGTTGATGCCTATCCGGCTTCGCCTATGCAGGAGGGTATCTTGCTGAGT
GGGCAGACGGGCAGCTGCTCGTACGCAACATATTGGATCTGGACTTGCACCGCCAACGGCGGCCATGAGATTGTC
TCGCCTCGGAGACTTGAGACGGCCTGGCGCGGTGTCGTCAGCCAGCACGCCATTCTATCCACCGTCTTCGCCCCC
CATCCTGAGGGAAGCGGCTTCGTTCAGATGGTGCTGGCCAAGCCGCGGATCCAAGTCTCACAGATGAGCGTCACA
ACCGGCACAGCAGCCGAGGCTCTATCCCGTCTTGAAAGACCTGAGATTGGGCCTGCTTCGCCTCTTCATGCCTTT
ACTGTTTGCCGCGGGGGTGCTGACCTGGTGGCTGCGGAGGTGATTCGACACATCAGAGGCTGCTCGAACTTCGAC
AAGGTATCGTATTGGGCTGCGTTTCTCGAGGGTGTGCGGCCTTGCGAGGTCGCTGTTTCGTTCGCTGCTTCAGAC
GCGGCTGGCGATGGCTTCACTTACATCCCCATTCCTTCCGAGTCTGTGAGGGGCGTCCGGGCCTTTTGCAGGGAG
ATGGAGGTGAGTCGATCTGCCTTCCTGCAGGTTATCTGGGCCATGGTTCTTTCGCAGCTCGTTGGCTTGCCCGAG
GTGTGTTTCGGCTATCTGGCTTCGGGGAGGGGAGAGGCTATCGATGGAATTGAGAGTATCGTTGGGCCGCTGGCC
AACATGCTCTATAGCCGCGTTGATCTGAGGGATTCCAAGGCTGGTGTTTTCAGGAAGACTTGGGTCGATTCTATT
GAGCACTTGAAGTATCAGCACGTTTCGCTTGCTCGGGTTCAGCACGCTATGGATCTGTCGGGACGGCGGCTCTTT
AACACGGCCATGTCGGTTCGCGAGGAAGATTGCTTTGAGAGTGATGAGAGGAGCATTTCGCTTGCATACCACAGC
CATCAGGATCCGCACGAGTATGATCTTCTTCTGGCAGGCTTCTTCCGTCGAGACGGTAGTATGAACTTGTCGATT
CAGTTTCGAGAGGCTACTGTCAGCAGGCAGCTGGCCGAGGAGGCGGCAGCAACTCTAGCCAAGGCCATCGACTAC
GCCATGACAAGACAGAAACACGAAGACTCGACGCTTGATGTAGCTTTCTTCCGTCACGTCGTCGGAAGTTCTGAA
TCGGAAACGATGGCGTTTTGGGGGGATTACCTCTCCGACTTGGACGCGAACTACTTTCCTCCGCTGAGAAAGCCA
TCATCTAAAGACGGTCGTCTCGTGCTTCGGGCTGGAACAGCGCGCTTCAGTTTCAACCGTCTGGATGAATATACC
GTCGCAGAAGTCGTGGCGGCGGCTTGGACCGTGATGGCGGCCAGAAAGGTTGGTTCTTCCGAGGCCTTGGTCGGC
GTTAGCAGCAGGGGCAGGGAGTTGCTGCTTCGCGTGAGGCTGGACTGGACGGTGAGCGGGACAGAGCTGTTGCAG
TTGGTAAGACGACAGCTGGTTCAGCGGCCTGGGTTTCACGTCATTCGGCGGGCGAGTGATGAGGCTGCCCTGGCG
TGCAACTTGCAGGCCAACCTTGTCATTGAGGAACGAGGCTCGACAACTTGCATGGCTCCGGATGCCATGGAGACT
ATCGACTATGACGTTGTCGTCAACTGCCAGGTCCAGGGGGAAGAGGCGTCGCTGACTGTCTGGTTCGATGGCAAC
TCGGTCAGCGAGCCCGTTGCCCGTTCTGCTGCTGCTCAGCTTCAGCACGTACTCGACTGGCTTTCCGACGACAAA
CGCCGCGAATCTAGCATCGTCGAGGCCATTGAAGCAACGGTCGAGGATCTCGAGCAGATCTGGGCTTGGAACACG
CCCGTCCCTGTCCCCGTCGAGAGATGCGTGCACGACATGATTCACCAGACGGCTCAGATGTATCCGCAAGCACAA
GCCGTCTGCGGCTGGGACGGAGACTTGACGTATCAGCAGCTGGACAGTCTGGCTACCGCTCTGGCTCATCGACTC
GTTGCTGAGGGAGCAACACGGGGCTGTTTAGTGCCGCTGTTGTTTGACAAGTCGGCGTGGATGCCTGTGGCGATG
CTGGCTGTCATCAAGGCTGGATCTGCTGCTGTGGCTATGGATACGACGCAGCCTGAAGGGCGTCTGCGGGATATC
TTGTCTCAGCTAGACGGTGGCCAAGTGGTCGTCTCGTCGGTGGCTAACGAGCATCTCGCCCGTCGTCTGAGCCGA
GGGAGAGAGCCCATTGTCGTCGGCAGAGATGCGCTGCCCCGATCAACAGCTATCGACAAGCTTCCAACCGTCTAC
CCTTCCGACACTCTCTATGCCGTCTTCACCTCGGGCAGCACCGGATCGCCCAAAGCAGCTCTGATAACGCACAGC
AACATGAGCAGTGCCGTCGTCTACCAGCAGGAGGCGCTAGAACTGACGAGGTCATCTCGCGTCTTTGACTTTGCC
TCGTACGCTTTTGACGTGGCCTGGGACAACTTTGTTCACGCTTTGACTTGTGGTGGTTGTCTCTGCATCCCGTCT
GAAGCTGAGCGACTGGAAGACGTTGAGGGTGCTGTCGTTGCATTGCGGGCTAATTATCTGCATATCACGCCTACG
TTGCTTCGGTGTCTGGACTGGTCGAAGCTAGGGGGTGTCAGCGTCGTTGTTCTCAGCGGCGAGCCCGTGCTGGCT
GAAGACTTGGCTATTGTGCCTGATTGTGTACGGATGGTGAATGCTTACGGTCCGGCAGAGACGAATGTTGTTACC
GTTCAAAAGCTGGATACAAGGTTGCCCGTCTCGATAGGACGTGGGACGGGGTCGTGTACGTGGATTGTTGACGTC
GACCGTGTCAGCTCCCTGACGCCAATCGGGACGGCTGGAGAGTTGTGGATTGAGGGGCCGTTGGTTGGAGACGGA
TACTTGAACGACTGCCGACGGACGAACGAGGTCTTTGTCGACGATCCGGACTGGTTGCTTCGAGGCACGGCGGAT
AGACCGGGCCGTAGCGGGAGGCTGTATCGGACGGGCGACCTTGTCCGATACAATAACGACGGCACGCTGTTATAC
TTGGGCCGAAGGGATTCGCAGGTGAAGATCAGGGGTCAGCGTGTTGAGCTGGGAGAGGTTGAGACGCGAGTGCGA
CAGGCCCTGGACTCATCCGTCTCCGCGGCCGTGGTGGCAGAGATGATACAGCCGGAAGCATCGCCTGATTCCATC
CTCGTTGTCTTTGTCAGTCTTCAGCACGTGGCTTTGAGCGACGATGAGCACGCCCAAGCTGTTGGACGAGCTACG
GCTGGTATAAAGGAACAGCTGTCAGAGAGGCTACCACGCTTCATGATACCAACCTCTTACATCCCGCTCTCCAAG
ATTCCCCTGACCGCTACGGGAAAGACGGATCGTCGGCGTTTGCGGGCCATGGGAGGTCTGATGACGATGCGTGAG
CTGGCGGCTCTCAGTCGAAAAGGTGTCATTAATCAACGACGGCAGCCGGAAACGGAGTCGGAGCTGCTGCTGCTG
CGGCTCTGGGCTGAGGTCCTCGACTGCAGTCTGGAGAGCATCTCTGCTGACGATGGCTTCATCGGCGTGGGCGGT
GATTCTGTTGGGGCTATGAGGCTTGTCAGTCTGGCGCGCGATAGGGGCTTTGGCCTCACTGTTCGAGATGTCTTT
CAGAAGCCGATGCTGCGCGACATGTCGACGTGTCTGAAGCCTTTGGGGAAATCGTCTTCGTTGTTCATTCGGCCG
TTTTCTCTCTTGGGTTCTGGAGAGGATGAGGCTCGTTGCTCGGCTGCTTTGCTCTGCGGCTTGAACAGAGACAGC
GTTGTGGACGTGCTGCCTTGTACGCCTTTGCAGAGAAGCCTCTTCATGCGAGAAGGGGAGTTTATGACGCGGCAT
GTGCTGGAGATATGCAAGCACATTGACCTGGACAAGTTTCGAACAAGTTGGGACCAGGTTGTCTTGCGCAACGCC
GTTATGCGGACTCGGATCGTGGAGATGAAAGGGGAGGGCTACGTGCAGGTTGTTACGGACGAGCCGACACTCTGG
ATGGCGTGTAAGAGCCTCGACGAGTGTGAGAAATACGCTGAGAGGAACAGAATGGGATGCGGGACGCGGTTGGCG
AGGCTGGCTGTCGTGGAGAGCGAGGGCTGTGCCTGGCTGGTGTGGGATATGCACTGGGCTCTGTACGACGGATGG
GCTCTGCGGTTGCTCTTGAAAGAGGCTGAGGGGATCTACTACGAGAAGCCTTGCCGGCCGTTGGGAGACACGTCG
GCTCTCGTCAGATACGTCCTCGATGGCAACCGGGAAGAGACGGCCAGTTTCTGGAGACGGCAGTTTACCGGCCTG
ACGAGCTTACCCTTCCCTCCCCTCTCAGCAACCAACGAGAACCCTCCGCAGATCAACAGCGAAGTCCAGCATAAA
CTCCCCCCGATCCTAACCCGAAGCGACGAATTCACCGCAGCAACCATCATCCGAGCCGGCCTCTCACTCGTCATA
GCCTGGACCCTCAACCAAGCCCACGAGGCCATCTTCGGCGCCACCGTCAGCGGCCGCCAAGCAGACATGAACGGA
ATAGAGCGCCTAGCCGGCCCCGTCTTCTCCACCGTGCCGCTCCGCATCCCCATCGACTGGCACGGCACGGCGGGA
CAGCTGCTTTCGCAGGTGCAGTCTCAGGCGGCGGAGATGGTGCCGTACGAGCAGACGGGCTTGGATGGGATCGCG
GGCGTGAGTGCCGAGGCTGAGGCGGCGGTTGGGTTTCGGACTTTGCTGGTGGTGCAGTCTGCGATTAAGAAGGGG
GATGTTCGGTTTCGGGATGAGGGTGCCAAGGTCTTTGCTCGGGGGCTCGTTGCTGAGAGGCATACTATTGTTGAG
CTTGGTCTTCGGTCGGGGGCTTATCCCCTGTATGTGGAGTTCAACCGGTTCTAG
Transcript >Ophun1|3318
ATGACTCTCCGAAAAGCCCGCGTCGACGGACATGTGAACGGCAAGACCGAAGTGACGATATGGGGCGCCTCCTTG
ACCTACGGACAGCTGCAGGATCTCTCAGCCGACTTTGCTTCGGAAGAGTGTGTCGAGGCCCTCGATATGAAGACT
AGTTCGCTGCTGCTGGCAGAGAGCAACAAGAGCCTGCGGACGGAACCGATTGAGATTGTTGTCGGCGCTCTCGTT
TACTGCTTCTCAAGAAAGTTCCGCCATCGTTGCATGCCGCTTGTCTTCGTGATCGGTGGCCGAGACCAAGACCAG
CCGCTGAGCGACTCACGTCCGGTCGTAATCCCTATCGAGAGCACCAGCACCCGACTTGAAGCCGTGATGCTAGCA
AAGGATGGCATGCGCGCGGAGCTGGCAACCCACGGGGTCTTAAGGAGCAGCAAAGTTGGGGAGCAGCTTGGGACG
TTGACGTTGGCGACCAAATCGGCTTGTGGGATTATTGTGATGCATGTCCAGGCGAGTTTCCGGCTGGGCCGAGTC
TTCATCCTGATACAGCTTGGTAGGAAAGACGAACAAGAGCTTCGGCTGGAGGATTGGGCCAGGGTCTTCATGGAC
GAGCTTGTGACAACTGCTGAGGAGCTACAGCGTGCGCCACCGAGGCTTACATTGTCTGACTTGCCCTTGCTCTCC
CTTTCTTACCACGGTCTCGATAGTCTGCTTCATCAGCAGCTCTTCGGTCTAAGAGTTGATCCAGGCAACGTGAAG
GATATATTCCCTTGCTCGCCGCTGCAGGAGGGCGTGCTTCTGAGCAAATCATCATACGACATTTCCTGGATATGG
AACTGCGTGCCTCCTCACGGCAGCGACGCCATCTCACCGGCTCGGCTGCAAGAGGCTTGGAAGACGGCTGTCCGT
CGGCACGATATGTTTTCTACCGTCTTCAGCATGCACCCGGAGGAGGACAGCTTCATACAGATTGTGATGGCTACG
CCGACGGCTCGGATCTTGCAGCTGCACTCGACTGCCTCCCCAGCTGGGAAACTGGCCGCGCTTGAAAAGCCGGTG
TTTAGAGCTGAAGAGCCTAAGCACCTCCTTACGATCTTGTCGCCTTTGAGCTCAGACGATACCATGGAGGATGTC
CCTAGCAGCATCGCTCTTCCGGCAGAGGCGCTGGCAGGTATCACGGGATTCTGCAGGAGAAAGAAGTTGACGCGG
TCTGTCTTCGTGCACATTGCTTGGGCCTTGGTTCTGTCTTACTTCACCGGCGCGGATGACGTCTGCTTTGGATAC
ATGGCTTCTGGTCGGGATATCCCGGTTGAAGGCGTGGATAGAGTCTTTGGTCCGTTGGCCAACACGGTCATCAGT
CGCATCGACCTGCGCACGCCCCTTGAGAAATTGATGACAGAGACGGCAGCAATGCTGAAGGAGCACAGGCGTCAC
CAGCAGACCTCGCTGGCCGAGATACAGCGAAGCCTGGGTGTATCTGGTGGTCGACGACTCTTCAACTCGCTGCTG
TCTCTCCTCAAGGCCACTGACACCGAGTCGCTTTTGTTTAAGAAGCATAGTCAGTTTGACTTGGTGCTCGAGGGC
TATCTCGAGGAGGGAAGCATCAGTCTTTGTCTCCACTACCGAGCCAAGGCTGTTCGTCGTGACGTGGCGGAGGAG
GTTTGCGTGTTGTTGATGCGTGCCATTGACTATGTCGTTTCGACAGAGGGAACAAATGGAGTCGTCAACGGGATC
CCAGACGGTCGTGTTTCGAGCCGGTTCTTTAAACACGCCGTTGGTGCAGACAAGCACTCGACAAGGGCATATTGG
CAGTGTCGCCTCGGTGAAGTGGAAAACCTTAACTTGGTCTTCTTGAAAGGGCCCAAGACTCCTTCGGTGAGGGAC
GCTGACGAGACAATCACGATGAGAGGCCTCGGACGAAAGCATCTCTGTACCACGGAGATGGCTGCAAGGGCGGCG
TGGTCCGTGATAGTGGCCCAAGCCAGCGAGTCGGACACGGCCTTATTTGGCGTATCGGTAACTGACGGACGGCAG
AGATTGATGGGTAAAGGGGCTTCAGTCTTGCCACTCGCCGTTTCTTTGGACTGGAGTGCCAGCGTCGACAGTTTC
ATGGAGTCGTTGCAGAAGCAGACTGAGGACATGGCGAGATACGAGGGCGTGAGTCTGCACTGGCTGCGTCAGATA
CAGCATCAAGCAGTCGACTTTCAGTCGCTGTTGGTTTGTCATGGCCGCCGAGACGTCGTGGACAGTTGGAACGGT
CCGTTTGTCTTGGAGCTTCGAGAGCTGGATGACGAGACGGCTTGTCTGCACATCAGCTTCGATTCCCGTGTCGTG
ACGAGAAGACGCGTTGTGCGGATTGGCCAACAGTTCGAGTACTTGGTGCGCGAGCTCCTAAACGGGAATAGGGGC
AAAGAGATGCTCCGAAACCTGCGCATCATCCCTCCACAACATCTCGACCACGTCTGGGCGTGGAACTGTACAGTT
CCCGAACCCGTCGAGTCGTCGGTTCAGGAGCTGATACGGGCTCGAGTGCTCGCTATGCCACGGGCTCTCGCTATC
GACGCCTGGGACGGTACTCTGACCTTTGCACAACTGGATGAGCGATCCGATGCGCTGGCTCGCCGACTCGTGGCC
GATGGTATTGGTCCAGGGGCCTTGGTGCCGCTGTGTTTCGAGAAGTCGATGTGGATGTCTGTTGCCATGCTGGGA
GTTATCAAGTCGGGAGCTGCGGCGGTGGGCTTGGATCCGAAGCAGCCGGAAGACCGGTTACGAGAAATCATCAAG
GCAGTACGCGCTCGACTCGTCTTGGCGTCGTCGTTCAAGGAGCATCTCGCGAGGAGGGTGAGTCGGTGCCCGGTT
CTGGTCGTCGACTCTAATCTTCAGGACGGGAACCAGCCGTTGCCGGCAGTCGATCCGTCCGAGATTGTCTACGCC
GTCTTCACGTCTGGGAGCACGGGAAAGCCAAAGGGCGTCTTGGTAACGCAGCGGAGCCTGAGCAGTGCAGCCGTC
TACCAGCGTGAGGCTTTCGGCTTCGGCCACGGTCCGCGGGTGCTGGACTTTTCGTCGTACTGTTTCGATGCAGCT
TGGTTCAATCTTGTGCTCACTTTGACGTCTGGAGGTTGTCTGTGCGTGCCGTCGGAGAAGCAGCTGGAGGGGGAG
CTCGAAGGGTGTTTCGAGAGATATGACATTGGGCTGGCTTTCTTGACGCCTTCTGTTGTCCGGCATCTTGATGTT
GATGCTCTTGGACGGCTTGATACGCTGCTGATTGGTGGTGAGATCGTGTTGCCGAGCGACGTGTCTGGCTTGTCT
GGCTATAAGACGCAGGTCAAGATTATCTATGGGCCCTCGGAGTGTACGCCCATGACGACCCGTCACGACTTGACG
GAAGACGGAACTATATCCATCGGCCGAGGAGTCGGTGTCTGCACCTGGATTGTCGATCAGGACCACGGCCAATCT
CTCGTACCAATCGGCATGATCGGCGAGCTCGTGCTGGAAGGGCCGCTGCTTGGACAAGGCTATATCGACGAGCCG
GAGAAGACGAAAGCCTCCTTTATACAGGATGCTACCTGGCTCCTACAAGGAAAAGGGGGGGTCGAGGGTCGGCAC
GGACGAATCTACCGGACAGGCGATCTGGTGCGGTACGACGACGACGGCAACATCGTTTATGTGAGGCGCAAAGAT
AGGCAGGTCAAGATCCGAGGACAGCGGGTGGAACTGGCTGAGGTCGAGCAGCACGTCTTGGAGCTTTTGCAGACC
GGTCATACCTTGGACACGACCAAGGCCCACGTCATAGCTGAGACGATGGAGGCAGAGAACAGCGGAAGCAGCATG
CTCGTCTCCTTTGTGTCTATACAAGGAGAGACAGAGGATGGTGATGAAGATGGAATGAAAGAACAGCATGCTGTC
CTCGTCCAAAGCTTGACCAGGGGCTTATCGAAACGGCTTTCTGATCGTGTACCGGCTTATATGGTGCCCGTGGCC
TTTATTCCCGTCAGGATTGTTCCGAAGACGTTGACCGGCAAGACGAATCAGGCTCGGCTTCGGGAAATTGGCCTA
GCCTGGTGGAAGCGGTGTCGTGCCATGATGAATGATGATGAAGATGAAGATGGCGAGGGAACTCGAGCATCGACT
AATATGGAGAGGATGCTTCAGGAGGTGTGGATGACGGTGCTCAATCTTCCAACTCGTCAACTCTTTTCCATCGAC
AAGGCCTTTACCAGGCTGGGAGGCGATTCCATCTCGGCTATGCAGGTCGTCTCCAAGTGCAGGGCCTTGAAGATT
ATTGTTCCGTCCGTCAGTGACGTCTTGGAAGCCAGCACGATCCGCAGGCTGGCGCCACGCTGCCACTTTCAGAAG
CGTCCGACTCAGCAAGATGAGAGAGGAGACGAGCTGGAAAGGGATGAAGCAGAGACGATGGCGGCTTTTTCTCTC
TCGCCGATGCAGCAGCGGTTGATGGACTTCTTTCCAGACGGCATCAACCACTTCAATCAAAGTTTCGTACTCGAA
ACGAAGAGGGAGCTTTCTGTTGAGGGAATCGTCGATGCTTTGCACGCGGTTGTCAAACGACACGGCATGCTTCGA
GCCCGGTTCCATAAGGACGACAAGGGAGTATGGGAGCAGTCTGTGGTAGGAGCCCGTCCAGATGCATTCGCTTTT
GCCTACCATGCAGCATCCAGCCGAGAAGAGGCGCTGGAAATCGGGCAGCAGAGACAGGAGAAGCTCGATATGGTC
AACGGCCCCGTCTTTGCCTGCGACTTGATTGACTTGAACGACAGTCAGATAGTCGTCCTCTCGGCTCACCACCTA
GTCGTCGACCTCGTCTCGTGGCGCCTCATCTGGAGGGATATTCAGGAGCACGTTCAGACGGGCTGTCTTGGTGGT
TCACATACAGCATCGTTTCGCACCTGGTGCAGGTTTCAGGCAGAGGCAGCCCGTCATCTGAGTCCCGAAGCTGTG
CTTCCGTACCCGGTGCCAGCGGCAGACTTGAGCTTCTGGGGCGTTTCTCCGGCTGAGAATACAGGTGCGAGATGT
GAGGACTTGTCGTTTGCTCTTGATTTGCGGGATACCGAGTTGCTGCTGGGCTACAGTAACGACGGATTGCGGACT
GAGCCCCTTGATATCCTGTTGGGTTCGTTTGCCTATTCTTTTGCCGAGGTTTTCTTCGAAAGAAGTTCTTCTCTT
CCGGCCATCTTCGTCGAGGGCCACGGCCGTGAACAGCTGGAGGCGGATGGGCTCGATGTCTCGGAGACGGTTGGA
TGGTTCACAACCATGTTACCTGTTGCCATCGACGGCAAGGCTGCAACGACAGTCGTTGAGGCGATTCGGTTGGCG
AAAGATACGAGACGCAGAGTTCCGGGAAAGGGACAGCCGTACTTTGCGTCACGACTCTACAGCCGCTCATGCCGT
TCGGTGTTTCGGAAGCACCATGATGTCGAGCTGCTCGTCAACTTTGCAGGGCGCTACCAGCAGTTGGAAAGCAGA
GATGGTCTGTTCCGGCTGGTGGATGCTTCCTTGCGAGTTGTCTCTGCCTCGGCCCGGCGATTTGCACTGATTGAA
GCCAACATGGTCGTCCAGAACGGGCGGCTCTCTGTCACCTTTACCTTTAACAAGGATATGAAGCATCAGTCGAGG
TTGAGGAGCTGGTTCCCTTGCTTCATGGATACGCTGACGGGGGCTGTGCGGATGCTTGAGGGATTGTCTCCGAGA
TTGACGCTCAGTGACGTCGGATTGCTATCGCTTTCGTACCGAGGGCTGAACCGCTTGTTGGACGAAGTGCTTCCT
GAGCTTGGGCTTGAGGCTGCTGATGTGGTTGATGCCTATCCGGCTTCGCCTATGCAGGAGGGTATCTTGCTGAGT
GGGCAGACGGGCAGCTGCTCGTACGCAACATATTGGATCTGGACTTGCACCGCCAACGGCGGCCATGAGATTGTC
TCGCCTCGGAGACTTGAGACGGCCTGGCGCGGTGTCGTCAGCCAGCACGCCATTCTATCCACCGTCTTCGCCCCC
CATCCTGAGGGAAGCGGCTTCGTTCAGATGGTGCTGGCCAAGCCGCGGATCCAAGTCTCACAGATGAGCGTCACA
ACCGGCACAGCAGCCGAGGCTCTATCCCGTCTTGAAAGACCTGAGATTGGGCCTGCTTCGCCTCTTCATGCCTTT
ACTGTTTGCCGCGGGGGTGCTGACCTGGTGGCTGCGGAGGTGATTCGACACATCAGAGGCTGCTCGAACTTCGAC
AAGGTATCGTATTGGGCTGCGTTTCTCGAGGGTGTGCGGCCTTGCGAGGTCGCTGTTTCGTTCGCTGCTTCAGAC
GCGGCTGGCGATGGCTTCACTTACATCCCCATTCCTTCCGAGTCTGTGAGGGGCGTCCGGGCCTTTTGCAGGGAG
ATGGAGGTGAGTCGATCTGCCTTCCTGCAGGTTATCTGGGCCATGGTTCTTTCGCAGCTCGTTGGCTTGCCCGAG
GTGTGTTTCGGCTATCTGGCTTCGGGGAGGGGAGAGGCTATCGATGGAATTGAGAGTATCGTTGGGCCGCTGGCC
AACATGCTCTATAGCCGCGTTGATCTGAGGGATTCCAAGGCTGGTGTTTTCAGGAAGACTTGGGTCGATTCTATT
GAGCACTTGAAGTATCAGCACGTTTCGCTTGCTCGGGTTCAGCACGCTATGGATCTGTCGGGACGGCGGCTCTTT
AACACGGCCATGTCGGTTCGCGAGGAAGATTGCTTTGAGAGTGATGAGAGGAGCATTTCGCTTGCATACCACAGC
CATCAGGATCCGCACGAGTATGATCTTCTTCTGGCAGGCTTCTTCCGTCGAGACGGTAGTATGAACTTGTCGATT
CAGTTTCGAGAGGCTACTGTCAGCAGGCAGCTGGCCGAGGAGGCGGCAGCAACTCTAGCCAAGGCCATCGACTAC
GCCATGACAAGACAGAAACACGAAGACTCGACGCTTGATGTAGCTTTCTTCCGTCACGTCGTCGGAAGTTCTGAA
TCGGAAACGATGGCGTTTTGGGGGGATTACCTCTCCGACTTGGACGCGAACTACTTTCCTCCGCTGAGAAAGCCA
TCATCTAAAGACGGTCGTCTCGTGCTTCGGGCTGGAACAGCGCGCTTCAGTTTCAACCGTCTGGATGAATATACC
GTCGCAGAAGTCGTGGCGGCGGCTTGGACCGTGATGGCGGCCAGAAAGGTTGGTTCTTCCGAGGCCTTGGTCGGC
GTTAGCAGCAGGGGCAGGGAGTTGCTGCTTCGCGTGAGGCTGGACTGGACGGTGAGCGGGACAGAGCTGTTGCAG
TTGGTAAGACGACAGCTGGTTCAGCGGCCTGGGTTTCACGTCATTCGGCGGGCGAGTGATGAGGCTGCCCTGGCG
TGCAACTTGCAGGCCAACCTTGTCATTGAGGAACGAGGCTCGACAACTTGCATGGCTCCGGATGCCATGGAGACT
ATCGACTATGACGTTGTCGTCAACTGCCAGGTCCAGGGGGAAGAGGCGTCGCTGACTGTCTGGTTCGATGGCAAC
TCGGTCAGCGAGCCCGTTGCCCGTTCTGCTGCTGCTCAGCTTCAGCACGTACTCGACTGGCTTTCCGACGACAAA
CGCCGCGAATCTAGCATCGTCGAGGCCATTGAAGCAACGGTCGAGGATCTCGAGCAGATCTGGGCTTGGAACACG
CCCGTCCCTGTCCCCGTCGAGAGATGCGTGCACGACATGATTCACCAGACGGCTCAGATGTATCCGCAAGCACAA
GCCGTCTGCGGCTGGGACGGAGACTTGACGTATCAGCAGCTGGACAGTCTGGCTACCGCTCTGGCTCATCGACTC
GTTGCTGAGGGAGCAACACGGGGCTGTTTAGTGCCGCTGTTGTTTGACAAGTCGGCGTGGATGCCTGTGGCGATG
CTGGCTGTCATCAAGGCTGGATCTGCTGCTGTGGCTATGGATACGACGCAGCCTGAAGGGCGTCTGCGGGATATC
TTGTCTCAGCTAGACGGTGGCCAAGTGGTCGTCTCGTCGGTGGCTAACGAGCATCTCGCCCGTCGTCTGAGCCGA
GGGAGAGAGCCCATTGTCGTCGGCAGAGATGCGCTGCCCCGATCAACAGCTATCGACAAGCTTCCAACCGTCTAC
CCTTCCGACACTCTCTATGCCGTCTTCACCTCGGGCAGCACCGGATCGCCCAAAGCAGCTCTGATAACGCACAGC
AACATGAGCAGTGCCGTCGTCTACCAGCAGGAGGCGCTAGAACTGACGAGGTCATCTCGCGTCTTTGACTTTGCC
TCGTACGCTTTTGACGTGGCCTGGGACAACTTTGTTCACGCTTTGACTTGTGGTGGTTGTCTCTGCATCCCGTCT
GAAGCTGAGCGACTGGAAGACGTTGAGGGTGCTGTCGTTGCATTGCGGGCTAATTATCTGCATATCACGCCTACG
TTGCTTCGGTGTCTGGACTGGTCGAAGCTAGGGGGTGTCAGCGTCGTTGTTCTCAGCGGCGAGCCCGTGCTGGCT
GAAGACTTGGCTATTGTGCCTGATTGTGTACGGATGGTGAATGCTTACGGTCCGGCAGAGACGAATGTTGTTACC
GTTCAAAAGCTGGATACAAGGTTGCCCGTCTCGATAGGACGTGGGACGGGGTCGTGTACGTGGATTGTTGACGTC
GACCGTGTCAGCTCCCTGACGCCAATCGGGACGGCTGGAGAGTTGTGGATTGAGGGGCCGTTGGTTGGAGACGGA
TACTTGAACGACTGCCGACGGACGAACGAGGTCTTTGTCGACGATCCGGACTGGTTGCTTCGAGGCACGGCGGAT
AGACCGGGCCGTAGCGGGAGGCTGTATCGGACGGGCGACCTTGTCCGATACAATAACGACGGCACGCTGTTATAC
TTGGGCCGAAGGGATTCGCAGGTGAAGATCAGGGGTCAGCGTGTTGAGCTGGGAGAGGTTGAGACGCGAGTGCGA
CAGGCCCTGGACTCATCCGTCTCCGCGGCCGTGGTGGCAGAGATGATACAGCCGGAAGCATCGCCTGATTCCATC
CTCGTTGTCTTTGTCAGTCTTCAGCACGTGGCTTTGAGCGACGATGAGCACGCCCAAGCTGTTGGACGAGCTACG
GCTGGTATAAAGGAACAGCTGTCAGAGAGGCTACCACGCTTCATGATACCAACCTCTTACATCCCGCTCTCCAAG
ATTCCCCTGACCGCTACGGGAAAGACGGATCGTCGGCGTTTGCGGGCCATGGGAGGTCTGATGACGATGCGTGAG
CTGGCGGCTCTCAGTCGAAAAGGTGTCATTAATCAACGACGGCAGCCGGAAACGGAGTCGGAGCTGCTGCTGCTG
CGGCTCTGGGCTGAGGTCCTCGACTGCAGTCTGGAGAGCATCTCTGCTGACGATGGCTTCATCGGCGTGGGCGGT
GATTCTGTTGGGGCTATGAGGCTTGTCAGTCTGGCGCGCGATAGGGGCTTTGGCCTCACTGTTCGAGATGTCTTT
CAGAAGCCGATGCTGCGCGACATGTCGACGTGTCTGAAGCCTTTGGGGAAATCGTCTTCGTTGTTCATTCGGCCG
TTTTCTCTCTTGGGTTCTGGAGAGGATGAGGCTCGTTGCTCGGCTGCTTTGCTCTGCGGCTTGAACAGAGACAGC
GTTGTGGACGTGCTGCCTTGTACGCCTTTGCAGAGAAGCCTCTTCATGCGAGAAGGGGAGTTTATGACGCGGCAT
GTGCTGGAGATATGCAAGCACATTGACCTGGACAAGTTTCGAACAAGTTGGGACCAGGTTGTCTTGCGCAACGCC
GTTATGCGGACTCGGATCGTGGAGATGAAAGGGGAGGGCTACGTGCAGGTTGTTACGGACGAGCCGACACTCTGG
ATGGCGTGTAAGAGCCTCGACGAGTGTGAGAAATACGCTGAGAGGAACAGAATGGGATGCGGGACGCGGTTGGCG
AGGCTGGCTGTCGTGGAGAGCGAGGGCTGTGCCTGGCTGGTGTGGGATATGCACTGGGCTCTGTACGACGGATGG
GCTCTGCGGTTGCTCTTGAAAGAGGCTGAGGGGATCTACTACGAGAAGCCTTGCCGGCCGTTGGGAGACACGTCG
GCTCTCGTCAGATACGTCCTCGATGGCAACCGGGAAGAGACGGCCAGTTTCTGGAGACGGCAGTTTACCGGCCTG
ACGAGCTTACCCTTCCCTCCCCTCTCAGCAACCAACGAGAACCCTCCGCAGATCAACAGCGAAGTCCAGCATAAA
CTCCCCCCGATCCTAACCCGAAGCGACGAATTCACCGCAGCAACCATCATCCGAGCCGGCCTCTCACTCGTCATA
GCCTGGACCCTCAACCAAGCCCACGAGGCCATCTTCGGCGCCACCGTCAGCGGCCGCCAAGCAGACATGAACGGA
ATAGAGCGCCTAGCCGGCCCCGTCTTCTCCACCGTGCCGCTCCGCATCCCCATCGACTGGCACGGCACGGCGGGA
CAGCTGCTTTCGCAGGTGCAGTCTCAGGCGGCGGAGATGGTGCCGTACGAGCAGACGGGCTTGGATGGGATCGCG
GGCGTGAGTGCCGAGGCTGAGGCGGCGGTTGGGTTTCGGACTTTGCTGGTGGTGCAGTCTGCGATTAAGAAGGGG
GATGTTCGGTTTCGGGATGAGGGTGCCAAGGTCTTTGCTCGGGGGCTCGTTGCTGAGAGGCATACTATTGTTGAG
CTTGGTCTTCGGTCGGGGGCTTATCCCCTGTATGTGGAGTTCAACCGGTTCTAG
Gene >Ophun1|3318
ATGACTCTCCGAAAAGCCCGCGTCGACGGACATGTGAACGGCAAGACCGAAGTGACGATATGGGGCGCCTCCTTG
ACCTACGGACAGCTGCAGGATCTCTCAGCCGACTTTGCTTCGGAAGAGTGTGTCGAGGCCCTCGATATGAAGACT
AGTTCGCTGCTGCTGGCAGAGAGCAACAAGAGCCTGCGGACGGAACCGATTGAGATTGTTGTCGGCGCTCTCGTT
TACTGCTTCTCAAGAAAGTTCCGCCATCGTTGCATGCCGCTTGTCTTCGTGATCGGTGGCCGAGACCAAGACCAG
CCGCTGAGCGACTCACGTCCGGTCGTAATCCCTATCGAGAGCACCAGCACCCGACTTGAAGCCGTGATGCTAGCA
AAGGATGGCATGCGCGCGGAGCTGGCAACCCACGGGGTCTTAAGGAGCAGCAAAGTTGGGGAGCAGCTTGGGACG
TTGACGTTGGCGACCAAATCGGCTTGTGGGATTATTGTGATGCATGTCCAGGCGAGTTTCCGGCTGGGCCGAGTC
TTCATCCTGATACAGCTTGGTAGGAAAGACGAACAAGAGCTTCGGCTGGAGGATTGGGCCAGGGTCTTCATGGAC
GAGCTTGTGACAACTGCTGAGGAGCTACAGCGTGCGCCACCGAGGCTTACATTGTCTGACTTGCCCTTGCTCTCC
CTTTCTTACCACGGTCTCGATAGTCTGCTTCATCAGCAGCTCTTCGGTCTAAGAGTTGATCCAGGCAACGTGAAG
GATATATTCCCTTGCTCGCCGCTGCAGGAGGGCGTGCTTCTGAGCAAATCATCATACGACATTTCCTGGATATGG
AACTGCGTGCCTCCTCACGGCAGCGACGCCATCTCACCGGCTCGGCTGCAAGAGGCTTGGAAGACGGCTGTCCGT
CGGCACGATATGTTTTCTACCGTCTTCAGCATGCACCCGGAGGAGGACAGCTTCATACAGATTGTGATGGCTACG
CCGACGGCTCGGATCTTGCAGCTGCACTCGACTGCCTCCCCAGCTGGGAAACTGGCCGCGCTTGAAAAGCCGGTG
TTTAGAGCTGAAGAGCCTAAGCACCTCCTTACGATCTGTCAGTCCGAGGCCGGAGAGGTTGCTTGCAGGCTAGAC
ATTTGTCACTCTCTCTGCGATGCATATTCCATCTCTATCCTGCTGCGGGACGTGTCTGATGCATACGAGGGCGAA
CATTTACCGACTTCTCCATCATTCGGAAGAGTCATTTCGTTCATCAACAGTCAACCGAGATCGGAGACTCTTGGC
TACTGGAACTCTTTTCTGGCGGGAGTCGAGACGTGCGAATTTCCAGTGTCGCCTTTGAGCTCAGACGATACCATG
GAGGATGTCCCTAGCAGCATCGCTCTTCCGGCAGAGGCGCTGGCAGGTATCACGGGATTCTGCAGGAGAAAGAAG
TTGACGCGGTCTGTCTTCGTGCACATTGCTTGGGCCTTGGTTCTGTCTTACTTCACCGGCGCGGATGACGTCTGC
TTTGGATACATGGCTTCTGGTCGGGATATCCCGGTTGAAGGCGTGGATAGAGTCTTTGGTCCGTTGGCCAACACG
GTCATCAGTCGCATCGACCTGCGCACGCCCCTTGAGAAATTGATGACAGAGACGGCAGCAATGCTGAAGGAGCAC
AGGCGTCACCAGCAGACCTCGCTGGCCGAGATACAGCGAAGCCTGGGTGTATCTGGTGGTCGACGACTCTTCAAC
TCGCTGCTGTCTCTCCTCAAGGCCACTGACACCGAGTCGCTTTTGTTTAAGAAGCATAGTCAGGTGCATGCGCAA
GATGTATGTTGACAGATCGGGGCTTTTGCTTTGCTGAGCGGTGACTGACTGGCGGCAGTTTGACTTGGTGCTCGA
GGGCTATCTCGAGGAGGGAAGCATCAGTCTTTGTCTCCACTACCGAGCCAAGGCTGTTCGTCGTGACGTGGCGGA
GGAGGTTTGCGTGTTGTTGATGCGTGCCATTGACTATGTCGTTTCGACAGAGGGAACAAATGGAGTCGTCAACGG
GATCCCAGACGGTCGTGTTTCGAGCCGGTTCTTTAAACACGCCGTTGGTGCAGACAAGCACTCGACAAGGGCATA
TTGGCAGTGTCGCCTCGGTGAAGTGGAAAACCTTAACTTGGTCTTCTTGAAAGGGCCCAAGACTCCTTCGGTGAG
GGACGCTGACGAGACAATCACGATGAGAGGCCTCGGACGAAAGCATCTCTGTACCACGGAGATGGCTGCAAGGGC
GGCGTGGTCCGTGATAGTGGCCCAAGCCAGCGAGTCGGACACGGCCTTATTTGGCGTATCGGTAACTGACGGACG
GCAGAGATTGATGGGTAAAGGGGCTTCAGTCTTGCCACTCGCCGTTTCTTTGGACTGGAGTGCCAGCGTCGACAG
TTTCATGGAGTCGTTGCAGAAGCAGACTGAGGACATGGCGAGATACGAGGGCGTGAGTCTGCACTGGCTGCGTCA
GATACAGCATCAAGCAGTCGACTTTCAGTCGCTGTTGGTTTGTCATGGCCGCCGAGACGTCGTGGACAGTTGGAA
CGGTCCGTTTGTCTTGGAGCTTCGAGAGCTGGATGACGAGACGGCTTGTCTGCACATCAGCTTCGATTCCCGTGT
CGTGACGAGAAGACGCGTTGTGCGGATTGGCCAACAGTTCGAGTACTTGGTGCGCGAGCTCCTAAACGGGAATAG
GGGCAAAGAGATGCTCCGAAACCTGCGCATCATCCCTCCACAACATCTCGACCACGTCTGGGCGTGGAACTGTAC
AGTTCCCGAACCCGTCGAGTCGTCGGTTCAGGAGCTGATACGGGCTCGAGTGCTCGCTATGCCACGGGCTCTCGC
TATCGACGCCTGGGACGGTACTCTGACCTTTGCACAACTGGATGAGCGATCCGATGCGCTGGCTCGCCGACTCGT
GGCCGATGGTATTGGTCCAGGGGCCTTGGTGCCGCTGTGTTTCGAGAAGTCGATGTGGATGTCTGTTGCCATGCT
GGGAGTTATCAAGTCGGGAGCTGCGGCGGTGGGCTTGGATCCGAAGCAGCCGGAAGACCGGTTACGAGAAATCAT
CAAGGCAGTACGCGCTCGACTCGTCTTGGCGTCGTCGTTCAAGGAGCATCTCGCGAGGAGGGTGAGTCGGTGCCC
GGTTCTGGTCGTCGACTCTAATCTTCAGGACGGGAACCAGCCGTTGCCGGCAGTCGATCCGTCCGAGATTGTCTA
CGCCGTCTTCACGTCTGGGAGCACGGGAAAGCCAAAGGGCGTCTTGGTAACGCAGCGGAGCCTGAGCAGTGCAGC
CGTCTACCAGCGTGAGGCTTTCGGCTTCGGCCACGGTCCGCGGGTGCTGGACTTTTCGTCGTACTGTTTCGATGC
AGCTTGGTTCAATCTTGTGCTCACTTTGACGTCTGGAGGTTGTCTGTGCGTGCCGTCGGAGAAGCAGCTGGAGGG
GGAGCTCGAAGGGTGTTTCGAGAGATATGACATTGGGCTGGCTTTCTTGACGCCTTCTGTTGTCCGGCATCTTGA
TGTTGATGCTCTTGGACGGCTTGATACGCTGCTGATTGGTGGTGAGATCGTGTTGCCGAGCGACGTGTCTGGCTT
GTCTGGCTATAAGACGCAGGTCAAGATTATCTATGGGCCCTCGGAGTGTACGCCCATGACGACCCGTCACGACTT
GACGGAAGACGGAACTATATCCATCGGCCGAGGAGTCGGTGTCTGCACCTGGATTGTCGATCAGGACCACGGCCA
ATCTCTCGTACCAATCGGCATGATCGGCGAGCTCGTGCTGGAAGGGCCGCTGCTTGGACAAGGCTATATCGACGA
GCCGGAGAAGACGAAAGCCTCCTTTATACAGGATGCTACCTGGCTCCTACAAGGAAAAGGGGGGGTCGAGGGTCG
GCACGGACGAATCTACCGGACAGGCGATCTGGTGCGGTACGACGACGACGGCAACATCGTTTATGTGAGGCGCAA
AGATAGGCAGGTCAAGATCCGAGGACAGCGGGTGGAACTGGCTGAGGTCGAGCAGCACGTCTTGGAGCTTTTGCA
GACCGGTCATACCTTGGACACGACCAAGGCCCACGTCATAGCTGAGACGATGGAGGCAGAGAACAGCGGAAGCAG
CATGCTCGTCTCCTTTGTGTCTATACAAGGAGAGACAGAGGATGGTGATGAAGATGGAATGAAAGAACAGCATGC
TGTCCTCGTCCAAAGCTTGACCAGGGGCTTATCGAAACGGCTTTCTGATCGTGTACCGGCTTATATGGTGCCCGT
GGCCTTTATTCCCGTCAGGATTGTTCCGAAGACGTTGACCGGCAAGACGAATCAGGCTCGGCTTCGGGAAATTGG
CCTAGCCTGGTGGAAGCGGTGTCGTGCCATGATGAATGATGATGAAGATGAAGATGGCGAGGGAACTCGAGCATC
GACTAATATGGAGAGGATGCTTCAGGAGGTGTGGATGACGGTGCTCAATCTTCCAACTCGTCAACTCTTTTCCAT
CGACAAGGCCTTTACCAGGCTGGGAGGCGATTCCATCTCGGCTATGCAGGTCGTCTCCAAGTGCAGGGCCTTGAA
GATTATTGTTCCGTCCGTCAGTGACGTCTTGGAAGCCAGCACGATCCGCAGGCTGGCGCCACGCTGCCACTTTCA
GAAGCGTCCGACTCAGCAAGATGAGAGAGGAGACGAGCTGGAAAGGGATGAAGCAGAGACGATGGCGGCTTTTTC
TCTCTCGCCGATGCAGCAGCGGTTGATGGACTTCTTTCCAGACGGCATCAACCACTTCAATCAAAGTTTCGTACT
CGAAACGAAGAGGGAGCTTTCTGTTGAGGGAATCGTCGATGCTTTGCACGCGGTTGTCAAACGACACGGCATGCT
TCGAGCCCGGTTCCATAAGGACGACAAGGGAGTATGGGAGCAGTCTGTGGTAGGAGCCCGTCCAGATGCATTCGC
TTTTGCCTACCATGCAGCATCCAGCCGAGAAGAGGCGCTGGAAATCGGGCAGCAGAGACAGGAGAAGCTCGATAT
GGTCAACGGCCCCGTCTTTGCCTGCGACTTGATTGACTTGAACGACAGTCAGATAGTCGTCCTCTCGGCTCACCA
CCTAGTCGTCGACCTCGTCTCGTGGCGCCTCATCTGGAGGGATATTCAGGAGCACGTTCAGACGGGCTGTCTTGG
TGGTTCACATACAGCATCGTTTCGCACCTGGTGCAGGTTTCAGGCAGAGGCAGCCCGTCATCTGAGTCCCGAAGC
TGTGCTTCCGTACCCGGTGCCAGCGGCAGACTTGAGCTTCTGGGGCGTTTCTCCGGCTGAGAATACAGGTGCGAG
ATGTGAGGACTTGTCGTTTGCTCTTGATTTGCGGGATACCGAGTTGCTGCTGGGCTACAGTAACGACGGATTGCG
GACTGAGCCCCTTGATATCCTGTTGGGTTCGTTTGCCTATTCTTTTGCCGAGGTTTTCTTCGAAAGAAGTTCTTC
TCTTCCGGCCATCTTCGTCGAGGGCCACGGCCGTGAACAGCTGGAGGCGGATGGGCTCGATGTCTCGGAGACGGT
TGGATGGTTCACAACCATGTTACCTGTTGCCATCGACGGCAAGGCTGCAACGACAGTCGTTGAGGCGATTCGGTT
GGCGAAAGATACGAGACGCAGAGTTCCGGGAAAGGGACAGCCGTACTTTGCGTCACGACTCTACAGCCGCTCATG
CCGTTCGGTGTTTCGGAAGCACCATGATGTCGAGCTGCTCGTCAACTTTGCAGGGCGCTACCAGCAGTTGGAAAG
CAGAGATGGTCTGTTCCGGCTGGTGGATGCTTCCTTGCGAGTTGTCTCTGCCTCGGCCCGGCGATTTGCACTGAT
TGAAGCCAACATGGTCGTCCAGAACGGGCGGCTCTCTGTCACCTTTACCTTTAACAAGGATATGAAGCATCAGTC
GAGGTTGAGGAGCTGGTTCCCTTGCTTCATGGATACGCTGACGGGGGCTGTGCGGATGCTTGAGGGATTGTCTCC
GAGATTGACGCTCAGTGACGTCGGATTGCTATCGCTTTCGTACCGAGGGCTGAACCGCTTGTTGGACGAAGTGCT
TCCTGAGCTTGGGCTTGAGGCTGCTGATGTGGTTGATGCCTATCCGGCTTCGCCTATGCAGGAGGGTATCTTGCT
GAGTGGGCAGACGGGCAGCTGCTCGTACGCAACATATTGGATCTGGACTTGCACCGCCAACGGCGGCCATGAGAT
TGTCTCGCCTCGGAGACTTGAGACGGCCTGGCGCGGTGTCGTCAGCCAGCACGCCATTCTATCCACCGTCTTCGC
CCCCCATCCTGAGGGAAGCGGCTTCGTTCAGATGGTGCTGGCCAAGCCGCGGATCCAAGTCTCACAGATGAGCGT
CACAACCGGCACAGCAGCCGAGGCTCTATCCCGTCTTGAAAGACCTGAGATTGGGCCTGCTTCGCCTCTTCATGC
CTTTACTGTTTGCCGCGGGGGTGCTGGTGAGGTTGCTTGCAGACTGGATATTAATCATGTCCTTATGGACGGGGC
ATCTCTTTCTTGCCTTGTTCAAGACCTGGTGGCTGCGTATGACTCTGAAGGCTGCTCGTTGGGGCTTCGGCCTTC
GTTTAGGGAGGTGATTCGACACATCAGAGGCTGCTCGAACTTCGACAAGGTATCGTATTGGGCTGCGTTTCTCGA
GGGTGTGCGGCCTTGCGAGGTCGCTGTTTCGTTCGCTGCTTCAGACGCGGCTGGCGATGGCTTCACTTACATCCC
CATTCCTTCCGAGTCTGTGAGGGGCGTCCGGGCCTTTTGCAGGGAGATGGAGGTGAGTCGATCTGCCTTCCTGCA
GGTTATCTGGGCCATGGTTCTTTCGCAGCTCGTTGGCTTGCCCGAGGTGTGTTTCGGCTATCTGGCTTCGGGGAG
GGGAGAGGCTATCGATGGAATTGAGAGTATCGTTGGGCCGCTGGCCAACATGCTCTATAGCCGCGTTGATCTGAG
GGATTCCAAGGCTGGTGTTTTCAGGAAGACTTGGGTCGATTCTATTGAGCACTTGAAGTATCAGCACGTTTCGCT
TGCTCGGGTTCAGCACGCTATGGATCTGTCGGGACGGCGGCTCTTTAACACGGCCATGTCGGTTCGCGAGGAAGA
TTGCTTTGAGAGTGATGAGAGGAGCATTTCGCTTGCATACCACAGCCATCAGGATCCGCACGAGGTAAGATGGTT
ATTTAAAGATGCTGAGTTGGACTGACAGGCGGACCACATAGTATGATCTTCTTCTGGCAGGCTTCTTCCGTCGAG
ACGGTAGTATGAACTTGTCGATTCAGTTTCGAGAGGCTACTGTCAGCAGGCAGCTGGCCGAGGAGGCGGCAGCAA
CTCTAGCCAAGGCCATCGACTACGCCATGACAAGACAGAAACACGAAGACTCGACGCTTGATGTAGCTTTCTTCC
GTCACGTCGTCGGAAGTTCTGAATCGGAAACGATGGCGTTTTGGGGGGATTACCTCTCCGACTTGGACGCGAACT
ACTTTCCTCCGCTGAGAAAGCCATCATCTAAAGACGGTCGTCTCGTGCTTCGGGCTGGAACAGCGCGCTTCAGTT
TCAACCGTCTGGATGAATATACCGTCGCAGAAGTCGTGGCGGCGGCTTGGACCGTGATGGCGGCCAGAAAGGTTG
GTTCTTCCGAGGCCTTGGTCGGCGTTAGCAGCAGGGGCAGGGAGTTGCTGCTTCGCGTGAGGCTGGACTGGACGG
TGAGCGGGACAGAGCTGTTGCAGTTGGTAAGACGACAGCTGGTTCAGCGGCCTGGGTTTCACGTCATTCGGCGGG
CGAGTGATGAGGCTGCCCTGGCGTGCAACTTGCAGGCCAACCTTGTCATTGAGGAACGAGGCTCGACAACTTGCA
TGGCTCCGGATGCCATGGAGACTATCGACTATGACGTTGTCGTCAACTGCCAGGTCCAGGGGGAAGAGGCGTCGC
TGACTGTCTGGTTCGATGGCAACTCGGTCAGCGAGCCCGTTGCCCGTTCTGCTGCTGCTCAGCTTCAGCACGTAC
TCGACTGGCTTTCCGACGACAAACGCCGCGAATCTAGCATCGTCGAGGCCATTGAAGCAACGGTCGAGGATCTCG
AGCAGATCTGGGCTTGGAACACGCCCGTCCCTGTCCCCGTCGAGAGATGCGTGCACGACATGATTCACCAGACGG
CTCAGATGTATCCGCAAGCACAAGCCGTCTGCGGCTGGGACGGAGACTTGACGTATCAGCAGCTGGACAGTCTGG
CTACCGCTCTGGCTCATCGACTCGTTGCTGAGGGAGCAACACGGGGCTGTTTAGTGCCGCTGTTGTTTGACAAGT
CGGCGTGGATGCCTGTGGCGATGCTGGCTGTCATCAAGGCTGGATCTGCTGCTGTGGCTATGGATACGACGCAGC
CTGAAGGGCGTCTGCGGGATATCTTGTCTCAGCTAGACGGTGGCCAAGTGGTCGTCTCGTCGGTGGCTAACGAGC
ATCTCGCCCGTCGTCTGAGCCGAGGGAGAGAGCCCATTGTCGTCGGCAGAGATGCGCTGCCCCGATCAACAGCTA
TCGACAAGCTTCCAACCGTCTACCCTTCCGACACTCTCTATGCCGTCTTCACCTCGGGCAGCACCGGATCGCCCA
AAGCAGCTCTGATAACGCACAGCAACATGAGCAGTGCCGTCGTCTACCAGCAGGAGGCGCTAGAACTGACGAGGT
CATCTCGCGTCTTTGACTTTGCCTCGTACGCTTTTGACGTGGCCTGGGACAACTTTGTTCACGCTTTGACTTGTG
GTGGTTGTCTCTGCATCCCGTCTGAAGCTGAGCGACTGGAAGACGTTGAGGGTGCTGTCGTTGCATTGCGGGCTA
ATTATCTGCATATCACGCCTACGTTGCTTCGGTGTCTGGACTGGTCGAAGCTAGGGGGTGTCAGCGTCGTTGTTC
TCAGCGGCGAGCCCGTGCTGGCTGAAGACTTGGCTATTGTGCCTGATTGTGTACGGATGGTGAATGCTTACGGTC
CGGCAGAGACGAATGTTGTTACCGTTCAAAAGCTGGATACAAGGTTGCCCGTCTCGATAGGACGTGGGACGGGGT
CGTGTACGTGGATTGTTGACGTCGACCGTGTCAGCTCCCTGACGCCAATCGGGACGGCTGGAGAGTTGTGGATTG
AGGGGCCGTTGGTTGGAGACGGATACTTGAACGACTGCCGACGGACGAACGAGGTCTTTGTCGACGATCCGGACT
GGTTGCTTCGAGGCACGGCGGATAGACCGGGCCGTAGCGGGAGGCTGTATCGGACGGGCGACCTTGTCCGATACA
ATAACGACGGCACGCTGTTATACTTGGGCCGAAGGGATTCGCAGGTGAAGATCAGGGGTCAGCGTGTTGAGCTGG
GAGAGGTTGAGACGCGAGTGCGACAGGCCCTGGACTCATCCGTCTCCGCGGCCGTGGTGGCAGAGATGATACAGC
CGGAAGCATCGCCTGATTCCATCCTCGTTGTCTTTGTCAGTCTTCAGCACGTGGCTTTGAGCGACGATGAGCACG
CCCAAGCTGTTGGACGAGCTACGGCTGGTATAAAGGAACAGCTGTCAGAGAGGCTACCACGCTTCATGATACCAA
CCTCTTACATCCCGCTCTCCAAGATTCCCCTGACCGCTACGGGAAAGACGGATCGTCGGCGTTTGCGGGCCATGG
GAGGTCTGATGACGATGCGTGAGCTGGCGGCTCTCAGTCGAAAAGGTGTCATTAATCAACGACGGCAGCCGGAAA
CGGAGTCGGAGCTGCTGCTGCTGCGGCTCTGGGCTGAGGTCCTCGACTGCAGTCTGGAGAGCATCTCTGCTGACG
ATGGCTTCATCGGCGTGGGCGGTGATTCTGTTGGGGCTATGAGGCTTGTCAGTCTGGCGCGCGATAGGGGCTTTG
GCCTCACTGTTCGAGATGTCTTTCAGAAGCCGATGCTGCGCGACATGTCGACGTGTCTGAAGCCTTTGGGGAAAT
CGTCTTCGTTGTTCATTCGGCCGTTTTCTCTCTTGGGTTCTGGAGAGGATGAGGCTCGTTGCTCGGCTGCTTTGC
TCTGCGGCTTGAACAGAGACAGCGTTGTGGACGTGCTGCCTTGTACGCCTTTGCAGAGAAGCCTCTTCATGCGAG
AAGGGGAGTTTATGACGCGGCATGTGCTGGAGATATGCAAGCACATTGACCTGGACAAGTTTCGAACAAGTTGGG
ACCAGGTTGTCTTGCGCAACGCCGTTATGCGGACTCGGATCGTGGAGATGAAAGGGGAGGGCTACGTGCAGGTTG
TTACGGACGAGCCGACACTCTGGATGGCGTGTAAGAGCCTCGACGAGTGTGAGAAATACGCTGAGAGGAACAGAA
TGGGATGCGGGACGCGGTTGGCGAGGCTGGCTGTCGTGGAGAGCGAGGGCTGTGCCTGGCTGGTGTGGGATATGC
ACTGGGCTCTGTACGACGGATGGGCTCTGCGGTTGCTCTTGAAAGAGGCTGAGGGGATCTACTACGAGAAGCCTT
GCCGGCCGTTGGGAGACACGTCGGCTCTCGTCAGATACGTCCTCGATGGCAACCGGGAAGAGACGGCCAGTTTCT
GGAGACGGCAGTTTACCGGCCTGACGAGCTTACCCTTCCCTCCCCTCTCAGCAACCAACGAGAACCCTCCGCAGA
TCAACAGCGAAGTCCAGCATAAACTCCCCCCGATCCTAACCCGAAGCGACGAATTCACCGCAGCAACCATCATCC
GAGCCGGCCTCTCACTCGTCATAGCCTGGACCCTCAACCAAGCCCACGAGGCCATCTTCGGCGCCACCGTCAGCG
GCCGCCAAGCAGACATGAACGGAATAGAGCGCCTAGCCGGCCCCGTCTTCTCCACCGTGCCGCTCCGCATCCCCA
TCGACTGGCACGGCACGGCGGGACAGCTGCTTTCGCAGGTGCAGTCTCAGGCGGCGGAGATGGTGCCGTACGAGC
AGACGGGCTTGGATGGGATCGCGGGCGTGAGTGCCGAGGCTGAGGCGGCGGTTGGGTTTCGGACTTTGCTGGTGG
TGCAGTCTGCGATTAAGAAGGGGGATGTTCGGTTTCGGGATGAGGGTGCCAAGGTCTTTGCTCGGGGGCTCGTTG
CTGAGAGGCATACTATTGTTGAGCTTGGTCTTCGGTCGGGGGCTTATCCCCTGTATGTGGAGTGTCAGCTTGACC
AGGGGGGGGGGGGAGACTTGCGACTCTGCTTCGACTCCGATGTCGTTGCGGAGAAGGTGGTGGCGAGGGTTGGAG
AGTTGCTTGTTGGGATCGTGGGGAGACTTTCTGATCCGTTGGGGGGGGGGGAGCGGTTGGGGCGTGTGCTGGAGG
GGTTGTTGTGATGAGGGTTTGTTTGGCGTGGTTGATGTAGGGATGCGGTTGCGGCTGTTGCTGGCGATGGTTATT
ACACAACTAAGCAGTCAACCAATCACAGTCAACCGGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail