Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3308
Gene name
LocationContig_295:3376..7254
Strand-
Gene length (bp)3878
Transcript length (bp)3168
Coding sequence length (bp)3168
Protein length (aa) 1056

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01300 Sua5_yciO_yrdC Telomere recombination 2.0E-53 682 856
PF03481 Sua5_C Threonylcarbamoyl-AMP synthase, C-terminal domain 1.5E-28 859 1051

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 667 1051 2.0E-85
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 621 1053 6.0E-79
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 651 1050 9.0E-71
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 651 1050 9.0E-66
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 665 1050 8.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 667 1051 2.0E-85
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 621 1053 6.0E-79
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 651 1050 9.0E-71
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 651 1050 9.0E-66
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 665 1050 8.0E-60
sp|P9WGC9|TSAC_MYCTU Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1301 PE=1 SV=1 682 868 3.0E-21
sp|P9WGC8|TSAC_MYCTO Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1340 PE=3 SV=1 682 868 3.0E-21
sp|P45831|TSAC_MYCLE Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium leprae (strain TN) GN=ML1136 PE=3 SV=1 682 868 8.0E-17
sp|Q499R4|YRDC_RAT YrdC domain-containing protein, mitochondrial OS=Rattus norvegicus GN=Yrdc PE=2 SV=1 661 844 4.0E-16
sp|Q60369|TSAC_METJA Putative threonylcarbamoyl-AMP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0062 PE=3 SV=1 665 866 4.0E-15
sp|Q0VTD8|TSAC_ALCBS Threonylcarbamoyl-AMP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tsaC PE=3 SV=1 682 844 2.0E-14
sp|Q1H4G9|TSAC_METFK Threonylcarbamoyl-AMP synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tsaC PE=3 SV=1 679 828 2.0E-14
sp|A1WZH9|TSAC_HALHL Threonylcarbamoyl-AMP synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tsaC PE=3 SV=1 666 831 3.0E-14
sp|Q3U5F4|YRDC_MOUSE YrdC domain-containing protein, mitochondrial OS=Mus musculus GN=Yrdc PE=1 SV=1 610 862 1.0E-13
sp|Q7MGL3|TSAC_VIBVY Threonylcarbamoyl-AMP synthase OS=Vibrio vulnificus (strain YJ016) GN=tsaC PE=3 SV=2 682 831 2.0E-13
sp|Q8DDD6|TSAC_VIBVU Threonylcarbamoyl-AMP synthase OS=Vibrio vulnificus (strain CMCP6) GN=tsaC PE=3 SV=1 682 831 2.0E-13
sp|Q3J7C4|TSAC_NITOC Threonylcarbamoyl-AMP synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tsaC PE=3 SV=1 682 845 3.0E-13
sp|Q86U90|YRDC_HUMAN YrdC domain-containing protein, mitochondrial OS=Homo sapiens GN=YRDC PE=1 SV=1 661 856 3.0E-13
sp|Q3SG43|TSAC_THIDA Threonylcarbamoyl-AMP synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tsaC PE=3 SV=1 682 844 1.0E-12
sp|Q0VC80|YRDC_BOVIN YrdC domain-containing protein, mitochondrial OS=Bos taurus GN=YRDC PE=2 SV=1 610 856 3.0E-12
sp|A8AQH7|TSAC_CITK8 Threonylcarbamoyl-AMP synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tsaC PE=3 SV=2 665 828 5.0E-12
sp|Q83JD1|TSAC_SHIFL Threonylcarbamoyl-AMP synthase OS=Shigella flexneri GN=tsaC PE=3 SV=4 671 828 6.0E-12
sp|Q0T019|TSAC_SHIF8 Threonylcarbamoyl-AMP synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=tsaC PE=3 SV=2 671 828 7.0E-12
sp|P45748|TSAC_ECOLI Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain K12) GN=tsaC PE=1 SV=2 671 828 9.0E-12
sp|B1IQ17|TSAC_ECOLC Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tsaC PE=3 SV=1 671 828 9.0E-12
sp|A8A587|TSAC_ECOHS Threonylcarbamoyl-AMP synthase OS=Escherichia coli O9:H4 (strain HS) GN=tsaC PE=3 SV=2 671 828 9.0E-12
sp|B1X6D5|TSAC_ECODH Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain K12 / DH10B) GN=tsaC PE=3 SV=1 671 828 9.0E-12
sp|Q8X8F8|TSAC_ECO57 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O157:H7 GN=tsaC PE=3 SV=1 671 828 9.0E-12
sp|Q31VZ4|TSAC_SHIBS Threonylcarbamoyl-AMP synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=tsaC PE=3 SV=1 671 829 1.0E-11
sp|A1SR31|TSAC_PSYIN Threonylcarbamoyl-AMP synthase OS=Psychromonas ingrahamii (strain 37) GN=tsaC PE=3 SV=1 666 817 1.0E-11
sp|Q6LLJ9|TSAC_PHOPR Threonylcarbamoyl-AMP synthase OS=Photobacterium profundum GN=tsaC PE=3 SV=2 665 831 2.0E-11
sp|A4WF91|TSAC_ENT38 Threonylcarbamoyl-AMP synthase OS=Enterobacter sp. (strain 638) GN=tsaC PE=3 SV=2 682 837 2.0E-11
sp|A9N8A7|TSAC_SALPB Threonylcarbamoyl-AMP synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tsaC PE=3 SV=1 682 828 2.0E-11
sp|Q57J68|TSAC_SALCH Threonylcarbamoyl-AMP synthase OS=Salmonella choleraesuis (strain SC-B67) GN=tsaC PE=3 SV=2 682 828 2.0E-11
sp|Q8ZLN0|TSAC_SALTY Threonylcarbamoyl-AMP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tsaC PE=3 SV=1 682 822 2.0E-11
sp|Q8Z1W6|TSAC_SALTI Threonylcarbamoyl-AMP synthase OS=Salmonella typhi GN=tsaC PE=3 SV=1 682 828 3.0E-11
sp|Q5PIS8|TSAC_SALPA Threonylcarbamoyl-AMP synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tsaC PE=3 SV=1 682 822 3.0E-11
sp|Q5QXJ5|TSAC_IDILO Threonylcarbamoyl-AMP synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tsaC PE=3 SV=1 671 830 3.0E-11
sp|Q3YWX6|TSAC_SHISS Threonylcarbamoyl-AMP synthase OS=Shigella sonnei (strain Ss046) GN=tsaC PE=3 SV=1 671 828 4.0E-11
sp|B2U2Q0|TSAC_SHIB3 Threonylcarbamoyl-AMP synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tsaC PE=3 SV=2 671 828 4.0E-11
sp|Q1R650|TSAC_ECOUT Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=tsaC PE=3 SV=2 671 828 4.0E-11
sp|B1LGN9|TSAC_ECOSM Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tsaC PE=3 SV=1 671 828 4.0E-11
sp|Q0TCH9|TSAC_ECOL5 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tsaC PE=3 SV=2 671 828 4.0E-11
sp|A1AGH4|TSAC_ECOK1 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O1:K1 / APEC GN=tsaC PE=3 SV=2 671 828 4.0E-11
sp|A7ZSH1|TSAC_ECO24 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tsaC PE=3 SV=2 671 828 4.0E-11
sp|Q8FD17|TSAC_ECOL6 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tsaC PE=3 SV=2 671 828 5.0E-11
sp|Q32B67|TSAC_SHIDS Threonylcarbamoyl-AMP synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tsaC PE=3 SV=1 671 828 7.0E-11
sp|A9MN84|TSAC_SALAR Threonylcarbamoyl-AMP synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tsaC PE=3 SV=2 682 828 9.0E-11
sp|A1TWN4|TSAC_MARHV Threonylcarbamoyl-AMP synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tsaC PE=3 SV=1 682 832 1.0E-10
sp|Q9KVT5|TSAC_VIBCH Threonylcarbamoyl-AMP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tsaC PE=3 SV=1 682 831 2.0E-10
sp|A5F4C5|TSAC_VIBC3 Threonylcarbamoyl-AMP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tsaC PE=3 SV=1 682 831 2.0E-10
sp|A1RDY7|TSAC_SHESW Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain W3-18-1) GN=tsaC PE=3 SV=1 682 845 2.0E-10
sp|A4Y1D2|TSAC_SHEPC Threonylcarbamoyl-AMP synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tsaC PE=3 SV=1 682 845 2.0E-10
sp|A6WHB6|TSAC_SHEB8 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS185) GN=tsaC PE=3 SV=1 682 845 2.0E-10
sp|A3CYL0|TSAC_SHEB5 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tsaC PE=3 SV=1 682 845 2.0E-10
sp|A9KUA7|TSAC_SHEB9 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS195) GN=tsaC PE=3 SV=1 682 845 3.0E-10
sp|B1KCX0|TSAC_SHEWM Threonylcarbamoyl-AMP synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tsaC PE=3 SV=1 679 846 3.0E-10
sp|A0KEX6|TSAC_AERHH Threonylcarbamoyl-AMP synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tsaC PE=3 SV=1 665 831 4.0E-10
sp|Q08A23|TSAC_SHEFN Threonylcarbamoyl-AMP synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tsaC PE=3 SV=1 682 845 5.0E-10
sp|Q493I0|TSAC_BLOPB Threonylcarbamoyl-AMP synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tsaC PE=3 SV=1 678 828 5.0E-10
sp|Q7P0L7|TSAC_CHRVO Threonylcarbamoyl-AMP synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tsaC PE=3 SV=1 682 844 5.0E-10
sp|Q7MYI5|TSAC_PHOLL Threonylcarbamoyl-AMP synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tsaC PE=3 SV=1 657 831 6.0E-10
sp|A7N129|TSAC_VIBCB Threonylcarbamoyl-AMP synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tsaC PE=3 SV=1 667 831 7.0E-10
sp|Q0A5B4|TSAC_ALKEH Threonylcarbamoyl-AMP synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tsaC PE=3 SV=1 657 830 8.0E-10
sp|Q5H5D8|TSAC_XANOR Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tsaC PE=3 SV=1 682 831 9.0E-10
sp|B2SL46|TSAC_XANOP Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tsaC PE=3 SV=1 682 831 9.0E-10
sp|Q2P833|TSAC_XANOM Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tsaC PE=3 SV=1 682 831 9.0E-10
sp|Q8PG13|TSAC_XANAC Threonylcarbamoyl-AMP synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tsaC PE=3 SV=1 682 831 1.0E-09
sp|A7MPF3|TSAC_CROS8 Threonylcarbamoyl-AMP synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tsaC PE=3 SV=1 664 822 1.0E-09
sp|Q9I7A5|TSAC_PSEAE Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tsaC PE=3 SV=1 682 831 1.0E-09
sp|Q02V59|TSAC_PSEAB Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tsaC PE=3 SV=1 682 831 1.0E-09
sp|B2FIS1|TSAC_STRMK Threonylcarbamoyl-AMP synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=tsaC PE=3 SV=1 667 809 2.0E-09
sp|A8FP81|TSAC_SHESH Threonylcarbamoyl-AMP synthase OS=Shewanella sediminis (strain HAW-EB3) GN=tsaC PE=3 SV=1 682 846 2.0E-09
sp|A6TET6|TSAC_KLEP7 Threonylcarbamoyl-AMP synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tsaC PE=3 SV=1 664 828 2.0E-09
sp|Q9PEV9|TSAC_XYLFA Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain 9a5c) GN=tsaC PE=3 SV=1 682 809 2.0E-09
sp|Q87AQ5|TSAC_XYLFT Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tsaC PE=3 SV=1 682 809 2.0E-09
sp|B2I8S9|TSAC_XYLF2 Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain M23) GN=tsaC PE=3 SV=2 682 809 2.0E-09
sp|Q3BNJ9|TSAC_XANC5 Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tsaC PE=3 SV=1 682 831 2.0E-09
sp|P57561|TSAC_BUCAI Threonylcarbamoyl-AMP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tsaC PE=3 SV=1 682 828 2.0E-09
sp|A1S1K5|TSAC_SHEAM Threonylcarbamoyl-AMP synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tsaC PE=3 SV=2 679 844 3.0E-09
sp|B1JJI2|TSAC_YERPY Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|Q664V8|TSAC_YERPS Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|A4TH27|TSAC_YERPP Threonylcarbamoyl-AMP synthase OS=Yersinia pestis (strain Pestoides F) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|Q1CCY0|TSAC_YERPN Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|A9R933|TSAC_YERPG Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|Q74XX5|TSAC_YERPE Threonylcarbamoyl-AMP synthase OS=Yersinia pestis GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|B2K500|TSAC_YERPB Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|Q1C2Y3|TSAC_YERPA Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|A7FNJ8|TSAC_YERP3 Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tsaC PE=3 SV=1 674 822 4.0E-09
sp|A1JRY6|TSAC_YERE8 Threonylcarbamoyl-AMP synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tsaC PE=3 SV=1 674 828 5.0E-09
sp|Q87KE2|TSAC_VIBPA Threonylcarbamoyl-AMP synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tsaC PE=3 SV=1 682 831 6.0E-09
sp|Q12TA0|TSAC_SHEDO Threonylcarbamoyl-AMP synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tsaC PE=3 SV=1 682 845 7.0E-09
sp|A8GKG1|TSAC_SERP5 Threonylcarbamoyl-AMP synthase OS=Serratia proteamaculans (strain 568) GN=tsaC PE=3 SV=1 682 828 8.0E-09
sp|B0U4N0|TSAC_XYLFM Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain M12) GN=tsaC PE=3 SV=2 682 806 9.0E-09
sp|A6UX84|TSAC_PSEA7 Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain PA7) GN=tsaC PE=3 SV=1 682 831 1.0E-08
sp|A3QJE8|TSAC_SHELP Threonylcarbamoyl-AMP synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tsaC PE=3 SV=1 682 844 1.0E-08
sp|Q15ZX7|TSAC_PSEA6 Threonylcarbamoyl-AMP synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tsaC PE=3 SV=1 682 828 2.0E-08
sp|Q2SQW8|TSAC_HAHCH Threonylcarbamoyl-AMP synthase OS=Hahella chejuensis (strain KCTC 2396) GN=tsaC PE=3 SV=1 682 808 2.0E-08
sp|Q8P4F2|TSAC_XANCP Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tsaC PE=3 SV=1 682 831 2.0E-08
sp|B0RWR5|TSAC_XANCB Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tsaC PE=3 SV=2 682 831 2.0E-08
sp|Q4UQ07|TSAC_XANC8 Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tsaC PE=3 SV=1 682 831 2.0E-08
sp|Q8K977|TSAC_BUCAP Threonylcarbamoyl-AMP synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tsaC PE=3 SV=1 674 822 2.0E-08
sp|B3PGZ1|TSAC_CELJU Threonylcarbamoyl-AMP synthase OS=Cellvibrio japonicus (strain Ueda107) GN=tsaC PE=3 SV=2 682 831 2.0E-08
sp|Q88RQ9|TSAC_PSEPK Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain KT2440) GN=tsaC PE=3 SV=1 663 831 2.0E-08
sp|A4ST51|TSAC_AERS4 Threonylcarbamoyl-AMP synthase OS=Aeromonas salmonicida (strain A449) GN=tsaC PE=3 SV=1 666 831 2.0E-08
sp|A4XNB6|TSAC_PSEMY Threonylcarbamoyl-AMP synthase OS=Pseudomonas mendocina (strain ymp) GN=tsaC PE=3 SV=1 682 832 2.0E-08
sp|Q4KKQ6|TSAC_PSEF5 Threonylcarbamoyl-AMP synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tsaC PE=3 SV=1 663 831 2.0E-08
sp|A5VWK1|TSAC_PSEP1 Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tsaC PE=3 SV=1 663 831 3.0E-08
sp|Q48AU1|TSAC_COLP3 Threonylcarbamoyl-AMP synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tsaC PE=3 SV=1 682 846 4.0E-08
sp|B0KF32|TSAC_PSEPG Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain GB-1) GN=tsaC PE=3 SV=1 663 831 4.0E-08
sp|Q0I0R7|TSAC_SHESR Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain MR-7) GN=tsaC PE=3 SV=1 682 844 6.0E-08
sp|Q0HPA1|TSAC_SHESM Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain MR-4) GN=tsaC PE=3 SV=1 682 844 6.0E-08
sp|A0KR66|TSAC_SHESA Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain ANA-3) GN=tsaC PE=3 SV=1 682 844 6.0E-08
sp|Q83AA2|TSAC_COXBU Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tsaC PE=3 SV=1 682 831 7.0E-08
sp|Q8EKQ3|TSAC_SHEON Threonylcarbamoyl-AMP synthase OS=Shewanella oneidensis (strain MR-1) GN=tsaC PE=3 SV=1 682 844 8.0E-08
sp|Q7VQB9|TSAC_BLOFL Threonylcarbamoyl-AMP synthase OS=Blochmannia floridanus GN=tsaC PE=3 SV=1 682 822 1.0E-07
sp|Q21PU1|TSAC_SACD2 Threonylcarbamoyl-AMP synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tsaC PE=3 SV=1 682 804 1.0E-07
sp|A8GYH9|TSAC_SHEPA Threonylcarbamoyl-AMP synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tsaC PE=3 SV=1 682 844 1.0E-07
sp|Q2NQQ7|TSAC_SODGM Threonylcarbamoyl-AMP synthase OS=Sodalis glossinidius (strain morsitans) GN=tsaC PE=3 SV=1 657 830 1.0E-07
sp|Q3KKE2|TSAC_PSEPF Threonylcarbamoyl-AMP synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tsaC PE=3 SV=1 667 831 2.0E-07
sp|A9KH21|TSAC_COXBN Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tsaC PE=3 SV=1 682 831 2.0E-07
sp|A9N9G8|TSAC_COXBR Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tsaC PE=3 SV=1 682 831 3.0E-07
sp|B1J499|TSAC_PSEPW Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain W619) GN=tsaC PE=3 SV=1 663 831 4.0E-07
sp|B0TLD6|TSAC_SHEHH Threonylcarbamoyl-AMP synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tsaC PE=3 SV=1 682 844 5.0E-07
sp|Q48QH8|TSAC_PSE14 Threonylcarbamoyl-AMP synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tsaC PE=3 SV=1 663 831 5.0E-07
sp|Q500S6|TSAC_PSEU2 Threonylcarbamoyl-AMP synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tsaC PE=3 SV=1 663 831 7.0E-07
sp|Q88B46|TSAC_PSESM Threonylcarbamoyl-AMP synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tsaC PE=3 SV=1 663 831 1.0E-06
sp|A1KWL6|TSAC_NEIMF Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tsaC PE=3 SV=2 682 845 1.0E-06
sp|Q9JXA4|TSAC_NEIMB Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=tsaC PE=3 SV=1 682 845 1.0E-06
sp|A1IP83|TSAC_NEIMA Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tsaC PE=3 SV=2 682 845 1.0E-06
sp|A9M4K6|TSAC_NEIM0 Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=tsaC PE=3 SV=1 682 845 1.0E-06
sp|Q1LT55|TSAC_BAUCH Threonylcarbamoyl-AMP synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tsaC PE=3 SV=1 682 806 1.0E-06
sp|Q1I2G9|TSAC_PSEE4 Threonylcarbamoyl-AMP synthase OS=Pseudomonas entomophila (strain L48) GN=tsaC PE=3 SV=1 675 832 1.0E-06
sp|Q5E1R5|TSAC_VIBF1 Threonylcarbamoyl-AMP synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tsaC PE=3 SV=1 682 831 2.0E-06
sp|Q3IDH7|TSAC_PSEHT Threonylcarbamoyl-AMP synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tsaC PE=3 SV=1 669 806 3.0E-06
sp|Q1QTJ8|TSAC_CHRSD Threonylcarbamoyl-AMP synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tsaC PE=3 SV=1 663 844 5.0E-06
sp|Q31JQ7|TSAC_THICR Threonylcarbamoyl-AMP synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=tsaC PE=3 SV=1 670 815 9.0E-06
sp|Q65WC1|TSAC_MANSM Threonylcarbamoyl-AMP synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tsaC PE=3 SV=1 682 822 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003723 RNA binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999745

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5076
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4601
Ophiocordyceps australis map64 (Brazil) OphauB2|2102
Ophiocordyceps camponoti-floridani Ophcf2|00322
Ophiocordyceps camponoti-rufipedis Ophun1|3308 (this protein)
Ophiocordyceps kimflemingae Ophio5|1337
Ophiocordyceps subramaniannii Hirsu2|2914

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3308
MPRYSTKYLAVCLCLLVVSVVGTDWPKLVPRRPPPEDGARSSEPASAPRTLYIVSRREPGVVVTNGIPADISIFT
QRRLEFESYQVQPHNSHAIIVAHENIISAVSCFLQRWTRARLKRITQFYIYEIERDDAISCPCPVLGRGNNLMYD
GYLVHDPWLRRDDQRLIRWAPLPLGMRRTAWMFTEALLPHMQWHDENPSRLPQEPLSVAAGPYRSEPQDCVLGQY
AGFTGMLSQEDIDEILGELDQDDEPGAMVTEEDMAGTNEDPECDAAQAQAAQQQLSHLTNTDLDLLFDDAEDVLQ
ALLSQEQFDQRDCSSAMSLFRGPYKRSTLSTGNCCQLLALVRERVRSHACSHFSQLRFGLKLASNSLAGGTYDDI
MLAIGFGTMTLAEHPSKYFDEEIPVDLEAAFGSSVVAVQDIRHFAVFSVPGQRSIADEWIIESLSLTGLCAGSHR
LAQVRIDVNEGFSRWGDDGDKTHYNGRIDINDWRWLSPDAETLTVAVQPPGQPHACTHLESLQVRLMLGSWWGQG
TWDKIYMDMGPGFLPGSGRLLLATEPSAGFDETIEVNLKQAFGSETVAISRILPDPTLIRLYSALSRDDRKSDEP
DGWRLSGFSLRGKCAVAHRLLTTPAAMETRILAVPPARALGRFRPGTGLSRLEEWQMTTEAGSADELKTAAAHLR
SESSSPVVAFPTETVYGLGADATRSAAVAAIYRAKGRPSDNPLIVHVADLTMLRRLLGPDGLLPSVYRPLVERFW
PGPLTILLPCPEPSPLAAEVTAGLSTFGVRMPASSLALSLIKLADVPVAAPSANASTRPSPTTAQHVMDDLGGRI
ELILDGGPCRVGVESTVVDGLCCPPAVLRPGGVAIEDLRRCPGWASVVKAYEDHGEEGKAATPRAPGMKYKHYSP
KASVVLYETSNREAGAGIPPADVDSVCIAADDARHGDAARIVGVVRTKRWRPGAGLCCAGLQRVSPLEPPLEQSD
SMYHVLVGSLRDRDGAHIGLIYDLDLGTDTGRIARGLFSALRELDGRGADTIFVDGIDGELDIAAAVMNRLRKAA
SETRA*
Coding >Ophun1|3308
ATGCCGCGGTATAGCACGAAGTATCTGGCCGTCTGCCTCTGCCTGCTCGTCGTCTCCGTCGTCGGGACAGACTGG
CCGAAGCTTGTGCCGCGCCGGCCGCCGCCGGAGGATGGTGCACGGAGCTCCGAGCCGGCTTCTGCTCCGAGGACC
TTGTACATCGTGAGCAGGCGGGAGCCCGGAGTTGTTGTGACGAACGGCATTCCCGCAGATATCAGCATCTTCACG
CAGAGGCGCCTCGAGTTTGAATCCTATCAGGTGCAGCCGCACAACTCTCATGCCATCATCGTCGCCCACGAGAAC
ATAATCTCGGCCGTCTCTTGCTTCCTGCAGCGCTGGACCCGGGCCCGCCTCAAGAGGATCACGCAGTTCTACATC
TACGAGATTGAGCGAGACGACGCCATCAGTTGCCCGTGCCCCGTGCTGGGCAGAGGCAACAATCTCATGTACGAC
GGCTACTTGGTTCACGACCCGTGGCTGAGAAGAGACGACCAGCGTCTAATCCGCTGGGCCCCTTTGCCCCTCGGG
ATGCGGAGGACGGCTTGGATGTTTACGGAGGCATTGCTCCCGCACATGCAGTGGCACGACGAGAACCCGTCCCGT
CTTCCGCAGGAGCCCTTGTCGGTCGCTGCCGGCCCGTACCGTTCAGAGCCACAGGACTGTGTGCTCGGCCAATAC
GCCGGCTTTACCGGCATGCTCTCGCAAGAGGACATCGACGAGATCCTCGGCGAGCTCGACCAAGACGATGAGCCG
GGTGCCATGGTCACGGAGGAGGACATGGCCGGTACCAACGAGGATCCGGAATGCGATGCTGCTCAAGCCCAAGCC
GCGCAGCAGCAACTCTCGCACCTCACCAATACGGACCTGGACCTGCTCTTCGACGACGCAGAAGATGTGCTGCAG
GCGCTCTTGAGCCAAGAACAGTTCGACCAAAGGGATTGCTCCTCCGCCATGAGCCTGTTCCGCGGCCCCTACAAG
AGGTCCACGCTTTCGACCGGAAACTGCTGCCAGTTGCTGGCCCTGGTCAGGGAGCGGGTTAGATCTCACGCTTGT
TCCCACTTCAGCCAGCTGCGCTTTGGCTTGAAGCTGGCGAGCAATAGCCTCGCGGGCGGCACATACGACGACATT
ATGCTCGCTATCGGCTTCGGTACCATGACGCTTGCTGAGCATCCGTCAAAGTATTTCGACGAGGAGATACCCGTA
GACCTCGAGGCGGCTTTTGGCTCATCCGTCGTTGCCGTGCAGGACATCCGGCACTTTGCCGTCTTCTCCGTGCCC
GGCCAACGATCTATCGCGGACGAGTGGATAATTGAGAGCCTTTCACTGACAGGACTCTGTGCCGGCTCGCACAGA
CTGGCGCAAGTCCGGATAGACGTCAACGAGGGCTTCTCCCGCTGGGGTGATGACGGTGACAAGACGCATTATAAC
GGCCGCATCGACATCAACGACTGGCGTTGGCTGTCTCCGGACGCCGAAACGCTCACTGTTGCCGTTCAACCTCCG
GGGCAGCCCCATGCCTGCACTCACCTCGAGAGCCTCCAAGTGAGACTGATGCTCGGAAGCTGGTGGGGGCAAGGA
ACTTGGGACAAGATATACATGGACATGGGCCCCGGCTTTCTGCCCGGCAGCGGCAGGCTGCTGCTCGCAACGGAA
CCTTCGGCCGGCTTCGATGAGACGATTGAGGTCAACTTGAAGCAGGCCTTTGGGTCCGAGACTGTCGCCATCAGC
CGTATCCTCCCGGACCCCACCCTCATACGACTGTACTCAGCCCTCTCGAGGGACGACCGGAAGAGCGACGAGCCG
GACGGGTGGAGGCTCTCGGGCTTCTCGTTGCGCGGCAAGTGCGCCGTGGCGCACCGCCTCCTGACCACTCCCGCC
GCGATGGAGACGCGCATCCTCGCCGTCCCTCCGGCCCGCGCCCTCGGCCGCTTCCGCCCCGGCACCGGCCTCTCC
CGCCTCGAAGAATGGCAGATGACGACAGAAGCCGGCTCAGCAGACGAACTGAAGACGGCAGCCGCGCATCTCCGA
TCGGAATCAAGCTCACCCGTCGTCGCCTTCCCCACGGAAACCGTCTACGGCCTCGGCGCCGACGCTACTCGCAGC
GCCGCCGTCGCCGCCATCTACCGCGCCAAGGGACGGCCGTCGGATAACCCGCTCATCGTACACGTGGCAGACCTG
ACGATGCTCCGTCGGCTGCTCGGCCCGGACGGCCTGCTGCCCTCGGTGTACCGCCCGCTGGTGGAGCGCTTCTGG
CCGGGGCCCTTGACCATCTTGCTGCCTTGTCCCGAGCCGTCACCGCTGGCGGCCGAGGTGACGGCCGGCCTCTCG
ACCTTTGGCGTCAGGATGCCCGCCTCGTCTCTGGCGCTGAGCCTCATCAAGCTTGCGGATGTGCCCGTGGCCGCT
CCTTCGGCGAATGCTTCTACGCGGCCGTCGCCCACGACGGCTCAGCATGTTATGGATGACCTGGGAGGACGCATC
GAGCTTATCCTTGACGGGGGACCGTGTCGCGTAGGCGTCGAGAGCACCGTCGTCGATGGTCTTTGCTGTCCGCCT
GCTGTGCTGAGGCCCGGCGGCGTCGCTATAGAAGACTTGCGTCGCTGTCCGGGTTGGGCCTCTGTCGTCAAGGCT
TACGAGGATCATGGCGAGGAGGGAAAGGCAGCGACGCCGCGGGCGCCCGGCATGAAGTACAAGCACTATAGTCCC
AAGGCGAGCGTCGTGCTGTACGAGACGTCGAATCGCGAGGCGGGGGCCGGTATCCCGCCCGCGGATGTCGACTCC
GTCTGCATTGCTGCTGATGACGCTCGTCATGGCGATGCTGCGAGGATAGTCGGCGTCGTCCGCACCAAGCGTTGG
AGGCCCGGAGCTGGGCTCTGCTGCGCCGGGCTGCAGCGGGTCTCTCCTCTCGAGCCTCCTCTCGAGCAGTCGGAC
TCGATGTACCATGTCCTGGTCGGCTCTCTCAGAGATCGAGACGGCGCGCATATCGGACTCATCTACGACTTGGAC
CTGGGGACGGACACGGGGAGGATAGCAAGGGGGCTGTTCTCTGCCCTGAGAGAACTCGATGGGCGTGGAGCGGAT
ACAATCTTTGTAGATGGTATAGATGGCGAGCTGGATATCGCCGCGGCAGTCATGAACCGCCTTCGCAAGGCGGCT
TCGGAAACCAGAGCATGA
Transcript >Ophun1|3308
ATGCCGCGGTATAGCACGAAGTATCTGGCCGTCTGCCTCTGCCTGCTCGTCGTCTCCGTCGTCGGGACAGACTGG
CCGAAGCTTGTGCCGCGCCGGCCGCCGCCGGAGGATGGTGCACGGAGCTCCGAGCCGGCTTCTGCTCCGAGGACC
TTGTACATCGTGAGCAGGCGGGAGCCCGGAGTTGTTGTGACGAACGGCATTCCCGCAGATATCAGCATCTTCACG
CAGAGGCGCCTCGAGTTTGAATCCTATCAGGTGCAGCCGCACAACTCTCATGCCATCATCGTCGCCCACGAGAAC
ATAATCTCGGCCGTCTCTTGCTTCCTGCAGCGCTGGACCCGGGCCCGCCTCAAGAGGATCACGCAGTTCTACATC
TACGAGATTGAGCGAGACGACGCCATCAGTTGCCCGTGCCCCGTGCTGGGCAGAGGCAACAATCTCATGTACGAC
GGCTACTTGGTTCACGACCCGTGGCTGAGAAGAGACGACCAGCGTCTAATCCGCTGGGCCCCTTTGCCCCTCGGG
ATGCGGAGGACGGCTTGGATGTTTACGGAGGCATTGCTCCCGCACATGCAGTGGCACGACGAGAACCCGTCCCGT
CTTCCGCAGGAGCCCTTGTCGGTCGCTGCCGGCCCGTACCGTTCAGAGCCACAGGACTGTGTGCTCGGCCAATAC
GCCGGCTTTACCGGCATGCTCTCGCAAGAGGACATCGACGAGATCCTCGGCGAGCTCGACCAAGACGATGAGCCG
GGTGCCATGGTCACGGAGGAGGACATGGCCGGTACCAACGAGGATCCGGAATGCGATGCTGCTCAAGCCCAAGCC
GCGCAGCAGCAACTCTCGCACCTCACCAATACGGACCTGGACCTGCTCTTCGACGACGCAGAAGATGTGCTGCAG
GCGCTCTTGAGCCAAGAACAGTTCGACCAAAGGGATTGCTCCTCCGCCATGAGCCTGTTCCGCGGCCCCTACAAG
AGGTCCACGCTTTCGACCGGAAACTGCTGCCAGTTGCTGGCCCTGGTCAGGGAGCGGGTTAGATCTCACGCTTGT
TCCCACTTCAGCCAGCTGCGCTTTGGCTTGAAGCTGGCGAGCAATAGCCTCGCGGGCGGCACATACGACGACATT
ATGCTCGCTATCGGCTTCGGTACCATGACGCTTGCTGAGCATCCGTCAAAGTATTTCGACGAGGAGATACCCGTA
GACCTCGAGGCGGCTTTTGGCTCATCCGTCGTTGCCGTGCAGGACATCCGGCACTTTGCCGTCTTCTCCGTGCCC
GGCCAACGATCTATCGCGGACGAGTGGATAATTGAGAGCCTTTCACTGACAGGACTCTGTGCCGGCTCGCACAGA
CTGGCGCAAGTCCGGATAGACGTCAACGAGGGCTTCTCCCGCTGGGGTGATGACGGTGACAAGACGCATTATAAC
GGCCGCATCGACATCAACGACTGGCGTTGGCTGTCTCCGGACGCCGAAACGCTCACTGTTGCCGTTCAACCTCCG
GGGCAGCCCCATGCCTGCACTCACCTCGAGAGCCTCCAAGTGAGACTGATGCTCGGAAGCTGGTGGGGGCAAGGA
ACTTGGGACAAGATATACATGGACATGGGCCCCGGCTTTCTGCCCGGCAGCGGCAGGCTGCTGCTCGCAACGGAA
CCTTCGGCCGGCTTCGATGAGACGATTGAGGTCAACTTGAAGCAGGCCTTTGGGTCCGAGACTGTCGCCATCAGC
CGTATCCTCCCGGACCCCACCCTCATACGACTGTACTCAGCCCTCTCGAGGGACGACCGGAAGAGCGACGAGCCG
GACGGGTGGAGGCTCTCGGGCTTCTCGTTGCGCGGCAAGTGCGCCGTGGCGCACCGCCTCCTGACCACTCCCGCC
GCGATGGAGACGCGCATCCTCGCCGTCCCTCCGGCCCGCGCCCTCGGCCGCTTCCGCCCCGGCACCGGCCTCTCC
CGCCTCGAAGAATGGCAGATGACGACAGAAGCCGGCTCAGCAGACGAACTGAAGACGGCAGCCGCGCATCTCCGA
TCGGAATCAAGCTCACCCGTCGTCGCCTTCCCCACGGAAACCGTCTACGGCCTCGGCGCCGACGCTACTCGCAGC
GCCGCCGTCGCCGCCATCTACCGCGCCAAGGGACGGCCGTCGGATAACCCGCTCATCGTACACGTGGCAGACCTG
ACGATGCTCCGTCGGCTGCTCGGCCCGGACGGCCTGCTGCCCTCGGTGTACCGCCCGCTGGTGGAGCGCTTCTGG
CCGGGGCCCTTGACCATCTTGCTGCCTTGTCCCGAGCCGTCACCGCTGGCGGCCGAGGTGACGGCCGGCCTCTCG
ACCTTTGGCGTCAGGATGCCCGCCTCGTCTCTGGCGCTGAGCCTCATCAAGCTTGCGGATGTGCCCGTGGCCGCT
CCTTCGGCGAATGCTTCTACGCGGCCGTCGCCCACGACGGCTCAGCATGTTATGGATGACCTGGGAGGACGCATC
GAGCTTATCCTTGACGGGGGACCGTGTCGCGTAGGCGTCGAGAGCACCGTCGTCGATGGTCTTTGCTGTCCGCCT
GCTGTGCTGAGGCCCGGCGGCGTCGCTATAGAAGACTTGCGTCGCTGTCCGGGTTGGGCCTCTGTCGTCAAGGCT
TACGAGGATCATGGCGAGGAGGGAAAGGCAGCGACGCCGCGGGCGCCCGGCATGAAGTACAAGCACTATAGTCCC
AAGGCGAGCGTCGTGCTGTACGAGACGTCGAATCGCGAGGCGGGGGCCGGTATCCCGCCCGCGGATGTCGACTCC
GTCTGCATTGCTGCTGATGACGCTCGTCATGGCGATGCTGCGAGGATAGTCGGCGTCGTCCGCACCAAGCGTTGG
AGGCCCGGAGCTGGGCTCTGCTGCGCCGGGCTGCAGCGGGTCTCTCCTCTCGAGCCTCCTCTCGAGCAGTCGGAC
TCGATGTACCATGTCCTGGTCGGCTCTCTCAGAGATCGAGACGGCGCGCATATCGGACTCATCTACGACTTGGAC
CTGGGGACGGACACGGGGAGGATAGCAAGGGGGCTGTTCTCTGCCCTGAGAGAACTCGATGGGCGTGGAGCGGAT
ACAATCTTTGTAGATGGTATAGATGGCGAGCTGGATATCGCCGCGGCAGTCATGAACCGCCTTCGCAAGGCGGCT
TCGGAAACCAGAGCATGA
Gene >Ophun1|3308
ATGCCGCGGTATAGCACGAAGTATCTGGCCGTCTGCCTCTGCCTGCTCGTCGTCTCCGTCGTCGGGACAGACTGG
CCGAAGCTTGTGCCGCGCCGGCCGCCGCCGGAGGATGGTGCACGGAGCTCCGAGCCGGCTTCTGCTCCGAGGACC
TTGTACATCGTGAGCAGGCGGGAGCCCGGAGTTGTTGTGACGAACGGCATTCCCGCAGATATCAGCATCTTCACG
CAGAGGCGCCTCGAGTTTGAATCCTATCAGGTGCAGCCGCACAACTCTCATGCCATCATCGTCGCCCACGAGAAC
ATAATCTCGGCCGTCTCTTGCTTCCTGCAGCGCTGGACCCGGGCCCGCCTCAAGAGGATCACGCAGTTCTACATC
TACGAGATTGAGCGAGACGACGCCATCAGTTGCCCGTGCCCCGTGCTGGGCAGAGGCAACAATCTCATGTACGAC
GGCTACTTGGTTCACGACCCGTGGCTGAGAAGAGACGACCAGCGTCTAATCCGCTGGGCCCCTTTGCCCCTCGGG
ATGCGGAGGACGGCTTGGATGTTTACGGAGGCATTGCTCCCGCACATGCAGTGGCACGACGAGAACCCGTCCCGT
CTTCCGCAGGAGCCCTTGTCGGTCGCTGCCGGCCCGTACCGTTCAGAGCCACAGGACTGTGTGCTCGGCCAATAC
GCCGGCTTTACCGGCATGCTCTCGCAAGAGGACATCGACGAGATCCTCGGCGAGCTCGACCAAGACGATGAGCCG
GGTGCCATGGTCACGGAGGAGGACATGGCCGGTACCAACGAGGATCCGGAATGCGATGCTGCTCAAGCCCAAGGT
AAGGGACGGACAGGACGTGCAAGTATTTAAGCCCGGCAAGTCTCTGATGGCCATGAGCCGCAACAGCCGCGCAGC
AGCAACTCTCGCACCTCACCAATACGGACCTGGACCTGCTCTTCGACGACGCAGAAGATGTGCTGCAGGCGCTCT
TGAGCCAAGAACAGTTCGACCAAAGGGATTGCTCCTCCGCCATGAGCCTGTTCCGCGGCCCCTACAAGAGGTCCA
CGCTTTCGACCGGTACGCCTGACGCGCGGTTCACACGAGACTTGCTTTGATGAGCTCACTGCTCGTGTCAAGGAA
ACTGCTGCCAGTTGCTGGCCCTGGTCAGGGAGCGGGTTAGATCTCACGCTTGTTCCCACTTCAGCCAGCTGCGCT
TTGGCTTGAAGCTGGCGAGCAATAGCCTCGCGGGCGGCACATACGACGACATTATGCTCGCTATCGGCTTCGGTA
CCATGACGCTTGCTGAGCATCCGTCAAAGTATTTCGACGAGGAGATACCCGTAGACCTCGAGGCGGCTTTTGGCT
CATCCGTCGTTGCCGTGCAGGACATCCGGCACTTTGCCGTCTTCTCCGTGCCCGGCCAACGATCTATCGCGGACG
AGTGGATAATTGAGAGTGAATTTCCTTGCCGAATCCCCTGGATAAGAGTATGCTGACTCGGGACCAACGTCAGGC
CTTTCACTGACAGGACTCTGTGCCGGCTCGCACAGACTGGCGCAAGTCCGGATAGACGTCAACGAGGGCTTCTCC
CGCTGGGGTGATGACGGTGACAAGACGCATTATAACGGCCGCATCGACATCAACGACTGGCGTTGGCTGTCTCCG
GACGCCGAAACGCTCACTGTTGCCGTTCAACCTCCGGGGCAGCCCCATGCCTGCACTCACCTCGAGAGCCTCCAA
GTGAGACTGATGCTCGGAAGCTGGTGGGGGCAAGGAACTTGGGACAAGATATACATGGACATGGGCCCCGGCTTT
CTGCCCGGCAGCGGCAGGCTGCTGCTCGCAACGGAACCTTCGGCCGGCTTCGATGAGACGATTGAGGTCAACTTG
AAGCAGGCCTTTGGGTCCGAGACTGTCGCCATCAGCCGTATCCTCCCGGACCCCACCCTCATACGACTGTACTCA
GCCCTCTCGAGGGACGACCGGAAGAGCGACGAGCCGGACGGGTGGAGGCTCTCGGGTAAGTCTGGAAGTGTTTAT
CAGGAGATGGATGGGCTTACCCTCGCCTGCAGGCTTCTCGTTGCGCGGCAAGTGCGCCGGTTCGCCGCGGACGGT
GGTGGCAGAAAGGTACGCCGGGGTGGACGTGGATTGTAAGCGATCTGTCGGAGAGGACTGGTCTGCAGTGTTTCA
CGGAGGCGGACTTCGTCTGCAGGACTGGCTGTGGGAGGACGGGAGATAGAGACGAGTGCTGTCAGCTGCTGTGCG
TAGCTTGTGGATGCTAGAGAACTCGTATATAGCCCGTAAGATCAGCCTCCTAGGTCAGGAGGGTTTCCTTTGTAA
AGTTGCTGTGACAGTTATAGTTGACAACTCATCGGTGATGGTGTTGACGAAGTTGATGAATGAGGATGACTGAGT
CAGCCGTCGTGGATAGCAGGGTGTCCGATTAGATTAGATAAACTAAGCCGATAAGATTAAAAAACCGTCGACGCA
TTTTACCCTCATCTTCAACCCGCAACGCCTCGTTCTCACTCACCCGAATCACCCTCAAGTCCAATACCTCATCAC
CCGAAGTGGCGCACCGCCTCCTGACCACTCCCGCCGCGATGGAGACGCGCATCCTCGCCGTCCCTCCGGCCCGCG
CCCTCGGCCGCTTCCGCCCCGGCACCGGCCTCTCCCGCCTCGAAGAATGGCAGATGACGACAGAAGCCGGCTCAG
CAGACGAACTGAAGACGGCAGCCGCGCATCTCCGATCGGAATCAAGCTCACCCGTCGTCGCCTTCCCCACGGAAA
CCGTCTACGGCCTCGGCGCCGACGCTACTCGCAGCGCCGCCGTCGCCGCCATCTACCGCGCCAAGGGACGGCCGT
CGGATAACCCGCTCATCGTACACGTGGCAGACCTGACGATGCTCCGTCGGCTGCTCGGCCCGGACGGCCTGCTGC
CCTCGGTGTACCGCCCGCTGGTGGAGCGCTTCTGGCCGGGGCCCTTGACCATCTTGCTGCCTTGTCCCGAGCCGT
CACCGCTGGCGGCCGAGGTGACGGCCGGCCTCTCGACCTTTGGCGTCAGGATGCCCGCCTCGTCTCTGGCGCTGA
GCCTCATCAAGCTTGCGGATGTGCCCGTGGCCGCTCCTTCGGCGAATGCTTCTACGCGGCCGTCGCCCACGACGG
CTCAGCATGTTATGGATGACCTGGGAGGACGCATCGAGCTTATCCTTGACGGGGGACCGTGTCGCGTAGGCGTCG
AGAGCACCGTCGTCGATGGTCTTTGCTGTCCGCCTGCTGTGCTGAGGCCCGGCGGCGTCGCTATAGAAGACTTGC
GTCGCTGTCCGGGTTGGGCCTCTGTCGTCAAGGCTTACGAGGATCATGGCGAGGAGGGAAAGGCAGCGACGCCGC
GGGCGCCCGGCATGAAGTACAAGCACTATAGTCCCAAGGCGAGCGTCGTGCTGTACGAGACGTCGAATCGCGAGG
CGGGGGCCGGTATCCCGCCCGCGGATGTCGACTCCGTCTGCATTGCTGCTGATGACGCTCGTCATGGCGATGCTG
CGAGGATAGTCGGCGTCGTCCGCACCAAGCGTTGGAGGCCCGGAGCTGGGCTCTGCTGCGCCGGGCTGCAGCGGG
TCTCTCCTCTCGAGCCTCCTCTCGAGCAGTCGGACTCGATGTACCATGTCCTGGTCGGCTCTCTCAGAGATCGAG
ACGGCGCGCATATCGGACTCATCTACGACTTGGACCTGGGGACGGACACGGGGAGGATAGCAAGGGGGCTGTTCT
CTGCCCTGAGAGAACTCGATGGGCGTGGAGCGGATACAATCTTTGTAGATGGTATAGATGGCGAGCTGGATATCG
CCGCGGCAGTCATGAACCGCCTTCGCAAGGCGGCTTCGGAAACCAGAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail