Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3304
Gene name
LocationContig_294:16536..18130
Strand+
Gene length (bp)1594
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 4.9E-07 302 341

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38486|LEG3_CANLF Galectin-3 OS=Canis lupus familiaris GN=LGALS3 PE=1 SV=3 132 235 1.0E-11
sp|P16110|LEG3_MOUSE Galectin-3 OS=Mus musculus GN=Lgals3 PE=1 SV=3 126 261 3.0E-08
sp|P38486|LEG3_CANLF Galectin-3 OS=Canis lupus familiaris GN=LGALS3 PE=1 SV=3 127 316 4.0E-08
sp|P47953|LEG3_CRILO Galectin-3 OS=Cricetulus longicaudatus GN=LGALS3 PE=2 SV=2 126 265 8.0E-08
sp|P17931|LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 126 261 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6641
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03761
Ophiocordyceps camponoti-rufipedis Ophun1|3304 (this protein)
Ophiocordyceps kimflemingae Ophio5|7507
Ophiocordyceps subramaniannii Hirsu2|4565

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3304
MATAVTAAPTKNEEPRCLTRFGPKLAPEQPGQTNNMTKRQAPPNNGGKIVYDIAFHMCGDRGQMQHAVSQQLELT
NQHFAQAGSKISFKPIEFRSLPQGCEQWRIDDEPLRQHLLEQIKMERRGRNGQQHPGGRPGGIPGGHPGGGFPGG
PSGGFPGGHPPGGFPGGHPPGGFPGGHPGGGFPGGHPPGGFPGGHPGGGFPGGPSGGFPGGHPGGGFPGGHPPDG
FPGGPPGGFPGVQRIDSAVIDIMIMASPRSNQRGLNRVLGMCDVGHPSYAARGCSILSSTLGSIGDQRQASVEGH
GFALTHEIGHFLGLMHTFGDGSSPQGACGEFDGFSDTAPQSAPTGQFCPNERNAVSGSRSPFPGSRSPFPGSRSP
FPGMAGDQGQCQCTPGANANNIMDYSLRIWNGLPCITFKRSTTFLNSRPNNMPAVEAATDRLEDGQAVLDSREAL
IREALIREALIREATSSGGGGPSRR*
Coding >Ophun1|3304
ATGGCCACGGCTGTGACAGCCGCCCCAACAAAGAATGAAGAGCCAAGATGTCTTACTCGCTTCGGGCCCAAGCTG
GCGCCGGAGCAGCCGGGGCAGACGAACAACATGACCAAACGGCAGGCTCCCCCTAACAACGGCGGGAAGATTGTC
TACGACATTGCCTTTCACATGTGTGGCGACAGAGGTCAGATGCAGCATGCTGTGTCTCAGCAGCTCGAGTTAACG
AACCAGCATTTCGCGCAGGCGGGCTCCAAGATCTCCTTCAAGCCTATCGAGTTCAGAAGTCTGCCTCAAGGTTGT
GAACAATGGCGTATCGATGACGAGCCACTACGCCAACATTTGTTGGAGCAGATTAAGATGGAGCGCCGAGGACGC
AACGGTCAGCAGCATCCCGGCGGACGCCCAGGCGGAATCCCCGGCGGACATCCAGGCGGTGGATTCCCCGGGGGC
CCTTCTGGTGGATTCCCCGGCGGACATCCTCCCGGTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGC
GGACATCCAGGCGGTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTC
CCCGGGGGCCCTTCTGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTTCCCGGAGGCCATCCTCCCGATGGA
TTCCCCGGCGGCCCTCCCGGTGGATTTCCCGGCGTCCAACGGATCGACTCGGCCGTCATCGATATCATGATCATG
GCCTCGCCTCGGAGCAACCAGAGGGGTCTCAATCGAGTTCTGGGAATGTGCGATGTAGGCCACCCCAGCTATGCA
GCCCGCGGATGCTCCATCCTCTCATCAACGCTTGGAAGCATCGGAGATCAACGCCAGGCATCTGTCGAGGGCCAC
GGCTTCGCCCTAACGCACGAGATTGGCCACTTCCTCGGTCTCATGCATACCTTTGGAGACGGATCCAGTCCACAG
GGAGCCTGCGGCGAATTTGATGGCTTTAGCGACACGGCGCCCCAGAGTGCTCCGACGGGACAATTTTGCCCTAAC
GAGAGGAATGCGGTGTCTGGCTCGAGGAGTCCATTTCCTGGCTCGAGGAGTCCGTTTCCTGGCTCGAGGAGTCCG
TTTCCTGGCATGGCTGGTGACCAGGGGCAGTGCCAATGTACGCCTGGGGCGAATGCGAACAACATAATGGACTAC
TCGTTGCGCATATGGAACGGGTTGCCCTGTATCACCTTCAAAAGATCAACGACTTTCCTCAACTCCCGGCCCAAC
AACATGCCTGCGGTGGAGGCGGCCACGGACCGATTGGAGGATGGCCAGGCGGTCCTGGATTCCCGGGAGGCCCTC
ATCCGGGAGGCCCTCATCCGGGAGGCCCTCATCCGGGAGGCGACATCTTCGGGGGGTGGTGGCCCTTCTAGGCGC
TGA
Transcript >Ophun1|3304
ATGGCCACGGCTGTGACAGCCGCCCCAACAAAGAATGAAGAGCCAAGATGTCTTACTCGCTTCGGGCCCAAGCTG
GCGCCGGAGCAGCCGGGGCAGACGAACAACATGACCAAACGGCAGGCTCCCCCTAACAACGGCGGGAAGATTGTC
TACGACATTGCCTTTCACATGTGTGGCGACAGAGGTCAGATGCAGCATGCTGTGTCTCAGCAGCTCGAGTTAACG
AACCAGCATTTCGCGCAGGCGGGCTCCAAGATCTCCTTCAAGCCTATCGAGTTCAGAAGTCTGCCTCAAGGTTGT
GAACAATGGCGTATCGATGACGAGCCACTACGCCAACATTTGTTGGAGCAGATTAAGATGGAGCGCCGAGGACGC
AACGGTCAGCAGCATCCCGGCGGACGCCCAGGCGGAATCCCCGGCGGACATCCAGGCGGTGGATTCCCCGGGGGC
CCTTCTGGTGGATTCCCCGGCGGACATCCTCCCGGTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGC
GGACATCCAGGCGGTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTC
CCCGGGGGCCCTTCTGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTTCCCGGAGGCCATCCTCCCGATGGA
TTCCCCGGCGGCCCTCCCGGTGGATTTCCCGGCGTCCAACGGATCGACTCGGCCGTCATCGATATCATGATCATG
GCCTCGCCTCGGAGCAACCAGAGGGGTCTCAATCGAGTTCTGGGAATGTGCGATGTAGGCCACCCCAGCTATGCA
GCCCGCGGATGCTCCATCCTCTCATCAACGCTTGGAAGCATCGGAGATCAACGCCAGGCATCTGTCGAGGGCCAC
GGCTTCGCCCTAACGCACGAGATTGGCCACTTCCTCGGTCTCATGCATACCTTTGGAGACGGATCCAGTCCACAG
GGAGCCTGCGGCGAATTTGATGGCTTTAGCGACACGGCGCCCCAGAGTGCTCCGACGGGACAATTTTGCCCTAAC
GAGAGGAATGCGGTGTCTGGCTCGAGGAGTCCATTTCCTGGCTCGAGGAGTCCGTTTCCTGGCTCGAGGAGTCCG
TTTCCTGGCATGGCTGGTGACCAGGGGCAGTGCCAATGTACGCCTGGGGCGAATGCGAACAACATAATGGACTAC
TCGTTGCGCATATGGAACGGGTTGCCCTGTATCACCTTCAAAAGATCAACGACTTTCCTCAACTCCCGGCCCAAC
AACATGCCTGCGGTGGAGGCGGCCACGGACCGATTGGAGGATGGCCAGGCGGTCCTGGATTCCCGGGAGGCCCTC
ATCCGGGAGGCCCTCATCCGGGAGGCCCTCATCCGGGAGGCGACATCTTCGGGGGGTGGTGGCCCTTCTAGGCGC
TGA
Gene >Ophun1|3304
ATGGCCACGGCTGTGACAGCCGCCCCAACAAAGAATGAAGAGCCAAGATGTCTTACTCGCTTCGGGCCCAAGCTG
GCGCCGGAGCAGCCGGGGCAGACGAACAACATGACCAAACGGCAGGCTCCCCCTAACAACGGCGGGAAGATTGTC
TACGACATTGCCTTTCACATGTGTGGCGACAGAGGTCAGATGCAGCATGTAAGTCCTCTTCAGAAGCCGATGTCG
GTCATTGCAGATACAACTCGCTAATCTCTAGGCAGGCTGTGTCTCAGCAGCTCGAGTTAACGAACCAGCATTTCG
CGCAGGCGGGCTCCAAGATCTCCTTCAAGCCTATCGAGTTCAGAAGTCTGCCTCAAGGTTGTGAACAATGGCGTA
TCGATGACGAGCCACTACGCCAACATTTGTTGGAGCAGATTAAGATGGAGCGCCGAGGACGCAACGGTCAGCAGC
ATCCCGGCGGACGCCCAGGCGGAATCCCCGGCGGACATCCAGGCGGTGGATTCCCCGGGGGCCCTTCTGGTGGAT
TCCCCGGCGGACATCCTCCCGGTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGCGGACATCCAGGCG
GTGGATTTCCCGGGGGCCATCCTCCCGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTCCCCGGGGGCCCTT
CTGGTGGATTCCCCGGCGGACATCCAGGCGGTGGATTTCCCGGAGGCCATCCTCCCGATGGATTCCCCGGCGGCC
CTCCCGGTGGATTTCCCGGCGTCCAACGGATCGACTCGGCCGTCATCGATATCATGATCATGGCCTCGCCTCGGA
GCAACCAGAGGGGTCTCAATCGAGTTCTGGGAATGTGCGATGTAGGCCACCCCAGCTATGCAGCCCGCGGATGCT
CCATCCTCTCATCAACGCTTGGAAGCATCGGAGATCAACGCCAGGCATCTGTCGAGGGCCACGGCTTCGCCCTAA
CGCACGAGATTGGCCACTTCCTCGGTCTCATGCATACCTTTGGAGACGGATCCAGTCCACAGGGAGCCTGCGGCG
AATTTGATGGCTTTAGCGACACGGCGCCCCAGAGTGCTCCGACGGGACAATTTTGCCCTAACGAGAGGAATGCGG
TGTCTGGCTCGAGGAGTCCATTTCCTGGCTCGAGGAGTCCGTTTCCTGGCTCGAGGAGTCCGTTTCCTGGCATGG
CTGGTGACCAGGGGCAGTGCCAATGTACGCCTGGGGCGAATGCGAACAACATAATGGACTACTCGTGAGTTTATC
CGCTGCTAACGTTGGCCTCTGTATGAGCTTCCATGTCTAATGTGTGTCTCGTCGAATAGGGGTTGTCTGGATCAG
ACGTTTTCTCCGCAGCAGGTTGCGCATATGGAACGGGTTGCCCTGTATCACCTTCAAAAGATCAACGACTTTCCT
CAACTCCCGGCCCAACAACATGCCTGCGGTGGAGGCGGCCACGGACCGATTGGAGGATGGCCAGGCGGTCCTGGA
TTCCCGGGAGGCCCTCATCCGGGAGGCCCTCATCCGGGAGGCCCTCATCCGGGAGGCGACATCTTCGGGGGGTGG
TGGCCCTTCTAGGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail