Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3297
Gene name
LocationContig_293:20457..21078
Strand-
Gene length (bp)621
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00137 ATP-synt_C ATP synthase subunit C 2.2E-10 84 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03672|ATP9_PODAS ATP synthase subunit 9, mitochondrial OS=Podospora anserina GN=ATP9 PE=3 SV=1 1 149 3.0E-70
sp|P00842|ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oli PE=1 SV=1 1 149 7.0E-66
sp|P16000|ATP9_EMENI ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp9 PE=3 SV=2 1 148 7.0E-41
sp|Q0H8W9|ATP9_USTMA ATP synthase subunit 9, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATP9 PE=3 SV=1 77 149 4.0E-22
sp|Q37695|ATP9_YARLI ATP synthase subunit 9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP9 PE=3 SV=1 77 145 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03672|ATP9_PODAS ATP synthase subunit 9, mitochondrial OS=Podospora anserina GN=ATP9 PE=3 SV=1 1 149 3.0E-70
sp|P00842|ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oli PE=1 SV=1 1 149 7.0E-66
sp|P16000|ATP9_EMENI ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp9 PE=3 SV=2 1 148 7.0E-41
sp|Q0H8W9|ATP9_USTMA ATP synthase subunit 9, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATP9 PE=3 SV=1 77 149 4.0E-22
sp|Q37695|ATP9_YARLI ATP synthase subunit 9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP9 PE=3 SV=1 77 145 1.0E-21
sp|Q37315|ATP9_DICDI ATP synthase subunit 9, mitochondrial OS=Dictyostelium discoideum GN=atp9 PE=3 SV=1 59 149 7.0E-21
sp|Q2LCR3|ATP9_DICCI ATP synthase subunit 9, mitochondrial OS=Dictyostelium citrinum GN=atp9 PE=3 SV=1 59 149 7.0E-21
sp|Q01554|ATP9_TRIRU ATP synthase subunit 9, mitochondrial OS=Trichophyton rubrum GN=ATP9 PE=3 SV=1 77 145 1.0E-20
sp|Q71S46|AT5G3_RAT ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus GN=Atp5g3 PE=2 SV=1 44 148 2.0E-20
sp|P48201|AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens GN=ATP5G3 PE=2 SV=1 44 148 2.0E-20
sp|Q06645|AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus GN=Atp5g1 PE=1 SV=1 24 148 2.0E-20
sp|P17605|AT5G1_SHEEP ATP synthase F(0) complex subunit C1, mitochondrial OS=Ovis aries GN=ATP5G1 PE=1 SV=2 39 148 3.0E-20
sp|P56384|AT5G3_MOUSE ATP synthase F(0) complex subunit C3, mitochondrial OS=Mus musculus GN=Atp5g3 PE=2 SV=1 22 148 3.0E-20
sp|P32876|AT5G1_BOVIN ATP synthase F(0) complex subunit C1, mitochondrial OS=Bos taurus GN=ATP5G1 PE=1 SV=1 39 148 3.0E-20
sp|Q5RFL2|AT5G3_PONAB ATP synthase F(0) complex subunit C3, mitochondrial OS=Pongo abelii GN=ATP5G3 PE=2 SV=1 44 148 4.0E-20
sp|Q9CR84|AT5G1_MOUSE ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus GN=Atp5g1 PE=2 SV=1 24 148 4.0E-20
sp|Q3ZC75|AT5G3_BOVIN ATP synthase F(0) complex subunit C3, mitochondrial OS=Bos taurus GN=ATP5G3 PE=2 SV=1 19 148 6.0E-20
sp|P05496|AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens GN=ATP5G1 PE=1 SV=2 24 148 8.0E-20
sp|Q5RAP9|AT5G2_PONAB ATP synthase F(0) complex subunit C2, mitochondrial OS=Pongo abelii GN=ATP5G2 PE=2 SV=1 55 148 1.0E-19
sp|A1XQS5|AT5G1_PIG ATP synthase F(0) complex subunit C1, mitochondrial OS=Sus scrofa GN=ATP5G1 PE=2 SV=1 38 148 3.0E-19
sp|P07926|AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus GN=ATP5G2 PE=1 SV=1 64 148 3.0E-19
sp|Q06056|AT5G2_SHEEP ATP synthase F(0) complex subunit C2, mitochondrial OS=Ovis aries GN=ATP5G2 PE=2 SV=1 64 148 3.0E-19
sp|P56383|AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus GN=Atp5g2 PE=2 SV=2 64 148 4.0E-19
sp|Q06055|AT5G2_HUMAN ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens GN=ATP5G2 PE=2 SV=1 64 148 4.0E-19
sp|Q9U505|AT5G_MANSE ATP synthase lipid-binding protein, mitochondrial OS=Manduca sexta PE=2 SV=1 24 148 4.0E-19
sp|Q06646|AT5G2_RAT ATP synthase F(0) complex subunit C2, mitochondrial OS=Rattus norvegicus GN=Atp5g2 PE=2 SV=1 64 148 6.0E-19
sp|P21537|ATP9_SCHPO ATP synthase subunit 9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp9 PE=3 SV=3 77 148 7.0E-18
sp|Q9BKS0|AT5G_CAEEL ATP synthase lipid-binding protein, mitochondrial OS=Caenorhabditis elegans GN=Y82E9BR.3 PE=3 SV=1 34 148 9.0E-18
sp|A8XDX2|AT5G_CAEBR ATP synthase lipid-binding protein, mitochondrial OS=Caenorhabditis briggsae GN=CBG11706 PE=3 SV=1 34 148 9.0E-18
sp|P48880|ATP9_CHOCR ATP synthase subunit 9, mitochondrial OS=Chondrus crispus GN=ATP9 PE=3 SV=1 81 149 1.0E-17
sp|A6H4Q2|ATP9_VANPO ATP synthase subunit 9, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATP9 PE=3 SV=1 77 148 3.0E-17
sp|P48881|ATP9_WICCA ATP synthase subunit 9, mitochondrial OS=Wickerhamomyces canadensis GN=ATP9 PE=3 SV=1 77 145 6.0E-17
sp|P61829|ATP9_YEAST ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLI1 PE=1 SV=1 77 148 1.0E-16
sp|P61828|ATP9_SACPA ATP synthase subunit 9, mitochondrial OS=Saccharomyces paradoxus GN=ATP9 PE=3 SV=1 77 148 1.0E-16
sp|P92811|ATP9_KLULA ATP synthase subunit 9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP9 PE=3 SV=1 77 145 2.0E-16
sp|Q75G38|ATP9_ASHGO ATP synthase subunit 9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP9 PE=3 SV=1 77 145 2.0E-16
sp|Q36852|ATP9_CYBMR ATP synthase subunit 9, mitochondrial OS=Cyberlindnera mrakii GN=ATP9 PE=3 SV=1 77 144 4.0E-15
sp|Q37377|ATP9_ACACA ATP synthase subunit 9, mitochondrial OS=Acanthamoeba castellanii GN=ATP9 PE=3 SV=1 75 148 1.0E-14
sp|Q9B8D5|ATP9_CANAL ATP synthase subunit 9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP9 PE=3 SV=1 81 145 2.0E-14
sp|A9RAH4|ATP9_DEBHA ATP synthase subunit 9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATP9 PE=3 SV=1 81 145 3.0E-14
sp|Q0BQY6|ATPL_GRABC ATP synthase subunit c OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpE PE=3 SV=1 78 148 4.0E-14
sp|Q3T4E5|ATP9_RHIOR ATP synthase subunit 9, mitochondrial OS=Rhizopus oryzae GN=atp9 PE=3 SV=1 77 145 1.0E-13
sp|P60112|ATP9_ARATH ATP synthase subunit 9, mitochondrial OS=Arabidopsis thaliana GN=ATP9 PE=2 SV=2 66 149 3.0E-13
sp|P60118|ATP9_PETHY ATP synthase subunit 9, mitochondrial OS=Petunia hybrida GN=ATP9 PE=2 SV=1 98 149 1.0E-12
sp|P60117|ATP9_SOLLC ATP synthase subunit 9, mitochondrial OS=Solanum lycopersicum GN=ATP9 PE=3 SV=1 98 149 1.0E-12
sp|P60116|ATP9_TOBAC ATP synthase subunit 9, mitochondrial OS=Nicotiana tabacum GN=ATP9 PE=2 SV=1 98 149 1.0E-12
sp|P26855|ATP9_MARPO ATP synthase subunit 9, mitochondrial OS=Marchantia polymorpha GN=ATP9 PE=3 SV=2 98 149 2.0E-12
sp|Q5FRW6|ATPL_GLUOX ATP synthase subunit c OS=Gluconobacter oxydans (strain 621H) GN=atpE PE=3 SV=1 70 148 3.0E-12
sp|P60114|ATP9_SOLTU ATP synthase subunit 9, mitochondrial OS=Solanum tuberosum GN=ATP9 PE=2 SV=1 98 149 3.0E-12
sp|P60115|ATP9_OENBI ATP synthase subunit 9, mitochondrial OS=Oenothera biennis GN=ATP9 PE=2 SV=1 98 149 3.0E-12
sp|Q12635|ATP9M_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-9 PE=3 SV=1 77 145 3.0E-12
sp|P15014|ATPL_RHORU ATP synthase subunit c OS=Rhodospirillum rubrum GN=atpE PE=3 SV=1 79 148 4.0E-12
sp|Q2RPA5|ATPL_RHORT ATP synthase subunit c OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpE PE=3 SV=1 79 148 4.0E-12
sp|P69422|ATP9_VICFA ATP synthase subunit 9, mitochondrial OS=Vicia faba GN=ATP9 PE=3 SV=1 98 149 5.0E-12
sp|P69421|ATP9_SOYBN ATP synthase subunit 9, mitochondrial OS=Glycine max GN=ATP9 PE=3 SV=1 98 149 5.0E-12
sp|P69420|ATP9_PEA ATP synthase subunit 9, mitochondrial OS=Pisum sativum GN=ATP9 PE=3 SV=1 98 149 5.0E-12
sp|Q2W027|ATPL_MAGSA ATP synthase subunit c OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpE PE=3 SV=1 81 148 6.0E-12
sp|P13547|ATP9_WHEAT ATP synthase subunit 9, mitochondrial OS=Triticum aestivum GN=ATP9 PE=1 SV=3 98 149 7.0E-12
sp|P00840|ATP9_MAIZE ATP synthase subunit 9, mitochondrial OS=Zea mays GN=ATP9 PE=2 SV=2 98 149 7.0E-12
sp|P0C518|ATP9_ORYSI ATP synthase subunit 9, mitochondrial OS=Oryza sativa subsp. indica GN=ATP9 PE=3 SV=1 98 149 7.0E-12
sp|P0C519|ATP9_ORYSJ ATP synthase subunit 9, mitochondrial OS=Oryza sativa subsp. japonica GN=ATP9 PE=2 SV=1 98 149 7.0E-12
sp|A9HDM8|ATPL_GLUDA ATP synthase subunit c OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpE PE=3 SV=1 81 149 2.0E-11
sp|P14571|ATP9_BETVU ATP synthase subunit 9, mitochondrial OS=Beta vulgaris GN=ATP9 PE=3 SV=1 98 148 4.0E-11
sp|Q85Q98|ATP9_CANGA ATP synthase subunit 9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP9 PE=3 SV=1 101 148 1.0E-10
sp|P60113|ATP9_BRANA ATP synthase subunit 9, mitochondrial OS=Brassica napus GN=ATP9 PE=2 SV=1 77 149 3.0E-10
sp|Q1RGZ2|ATPL_RICBR ATP synthase subunit c OS=Rickettsia bellii (strain RML369-C) GN=atpE PE=3 SV=1 82 149 6.0E-10
sp|A8GUJ2|ATPL_RICB8 ATP synthase subunit c OS=Rickettsia bellii (strain OSU 85-389) GN=atpE PE=3 SV=1 82 149 6.0E-10
sp|Q37550|ATP9_MALDO ATP synthase subunit 9, mitochondrial OS=Malus domestica GN=ATP9 PE=3 SV=1 77 145 1.0E-09
sp|A8EX89|ATPL_RICCK ATP synthase subunit c OS=Rickettsia canadensis (strain McKiel) GN=atpE PE=3 SV=1 82 149 2.0E-09
sp|C0R5U2|ATPL_WOLWR ATP synthase subunit c OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpE PE=3 SV=1 82 148 6.0E-09
sp|B3CLG2|ATPL_WOLPP ATP synthase subunit c OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpE PE=3 SV=1 82 148 6.0E-09
sp|Q73HW2|ATPL_WOLPM ATP synthase subunit c OS=Wolbachia pipientis wMel GN=atpE PE=3 SV=1 82 148 6.0E-09
sp|Q2GE12|ATPL_NEOSM ATP synthase subunit c OS=Neorickettsia sennetsu (strain Miyayama) GN=atpE PE=3 SV=1 82 149 7.0E-09
sp|Q07060|ATP9_PETSP ATP synthase subunit 9, mitochondrial OS=Petunia sp. GN=ATP9 PE=3 SV=1 77 149 4.0E-08
sp|P17254|ATP9_HELAN ATP synthase subunit 9, mitochondrial OS=Helianthus annuus GN=ATP9 PE=3 SV=2 98 145 5.0E-08
sp|Q9ZEC2|ATPL_RICPR ATP synthase subunit c OS=Rickettsia prowazekii (strain Madrid E) GN=atpE PE=3 SV=1 82 149 7.0E-08
sp|C3PM50|ATPL_RICAE ATP synthase subunit c OS=Rickettsia africae (strain ESF-5) GN=atpE PE=3 SV=1 82 149 9.0E-08
sp|C4K0P2|ATPL_RICPU ATP synthase subunit c OS=Rickettsia peacockii (strain Rustic) GN=atpE PE=3 SV=1 82 149 1.0E-07
sp|A8GLV9|ATPL_RICAH ATP synthase subunit c OS=Rickettsia akari (strain Hartford) GN=atpE PE=3 SV=1 82 149 1.0E-07
sp|Q92JP1|ATPL_RICCN ATP synthase subunit c OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpE PE=3 SV=2 82 149 1.0E-07
sp|Q4UNH9|ATPL_RICFE ATP synthase subunit c OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpE PE=3 SV=1 82 149 1.0E-07
sp|Q68XQ0|ATPL_RICTY ATP synthase subunit c OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpE PE=3 SV=1 82 149 2.0E-07
sp|A1SHI6|ATPL_NOCSJ ATP synthase subunit c OS=Nocardioides sp. (strain BAA-499 / JS614) GN=atpE PE=3 SV=1 78 145 9.0E-07
sp|B3CQT8|ATPL_ORITI ATP synthase subunit c OS=Orientia tsutsugamushi (strain Ikeda) GN=atpE PE=3 SV=1 82 149 2.0E-06
sp|A5CDC6|ATPL_ORITB ATP synthase subunit c OS=Orientia tsutsugamushi (strain Boryong) GN=atpE PE=3 SV=1 82 149 2.0E-06
sp|Q0C0X2|ATPL_HYPNA ATP synthase subunit c OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpE PE=3 SV=1 82 149 2.0E-06
sp|Q4L7Y9|ATPL_STAHJ ATP synthase subunit c OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpE PE=3 SV=1 90 148 3.0E-06
sp|Q4A8W4|ATPL_MYCH7 ATP synthase subunit c OS=Mycoplasma hyopneumoniae (strain 7448) GN=atpE PE=3 SV=1 52 149 3.0E-06
sp|B9DME9|ATPL_STACT ATP synthase subunit c OS=Staphylococcus carnosus (strain TM300) GN=atpE PE=3 SV=1 83 148 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015078 proton transmembrane transporter activity Yes
GO:1902600 proton transmembrane transport Yes
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain Yes
GO:0051179 localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0015075 ion transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 121 143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3297
MAAARVFASRLASQMGSRAARPALRAPVAASARRSLTASAGPLQALRRQQANSLLQASRNVVRFQRRAYSSEIAQ
AMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNAVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFT*
Coding >Ophun1|3297
ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG
GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAG
GCCAACAGCTTGCTCCAGGCGAGCCGGAATGTCGTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAG
GCCATGGTCGAGGTCTCCAAGAACCTGGGCATGGGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATC
GGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTGGCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCC
ATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGTCTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTACCTAA
Transcript >Ophun1|3297
ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG
GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAG
GCCAACAGCTTGCTCCAGGCGAGCCGGAATGTCGTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAG
GCCATGGTCGAGGTCTCCAAGAACCTGGGCATGGGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATC
GGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTGGCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCC
ATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGTCTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTACCTAA
Gene >Ophun1|3297
ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG
GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGGTATGGTGAAGCGCGAGAAAAGTTTTTTCTTGCTGTCC
TTTTCGTCTCCTGAAGCTCCCCCCGAGCTCCTCTTGGTCCATACTCGCTGTCCAACACCTCACTGACGCCCCCAT
TCAGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAGGCCAACAGCTTGCTCCAGGCGAGCCGGAATGTC
GTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAGGCCATGGTCGAGGTCTCCAAGAACCTGGGCATG
GGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATCGGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTG
GCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCCATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGT
CTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTGTGCGTACCAACCTGGTTGCTTCTCGTCGAATGACACGT
CTGACACGCTGGTAGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail