© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|3297 |
| Gene name | |
| Location | Contig_293:20457..21078 |
| Strand | - |
| Gene length (bp) | 621 |
| Transcript length (bp) | 450 |
| Coding sequence length (bp) | 450 |
| Protein length (aa) | 150 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00137 | ATP-synt_C | ATP synthase subunit C | 2.2E-10 | 84 | 145 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q03672|ATP9_PODAS | ATP synthase subunit 9, mitochondrial OS=Podospora anserina GN=ATP9 PE=3 SV=1 | 1 | 149 | 3.0E-70 |
| sp|P00842|ATP9_NEUCR | ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oli PE=1 SV=1 | 1 | 149 | 7.0E-66 |
| sp|P16000|ATP9_EMENI | ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp9 PE=3 SV=2 | 1 | 148 | 7.0E-41 |
| sp|Q0H8W9|ATP9_USTMA | ATP synthase subunit 9, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATP9 PE=3 SV=1 | 77 | 149 | 4.0E-22 |
| sp|Q37695|ATP9_YARLI | ATP synthase subunit 9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP9 PE=3 SV=1 | 77 | 145 | 1.0E-21 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q03672|ATP9_PODAS | ATP synthase subunit 9, mitochondrial OS=Podospora anserina GN=ATP9 PE=3 SV=1 | 1 | 149 | 3.0E-70 |
| sp|P00842|ATP9_NEUCR | ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oli PE=1 SV=1 | 1 | 149 | 7.0E-66 |
| sp|P16000|ATP9_EMENI | ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atp9 PE=3 SV=2 | 1 | 148 | 7.0E-41 |
| sp|Q0H8W9|ATP9_USTMA | ATP synthase subunit 9, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATP9 PE=3 SV=1 | 77 | 149 | 4.0E-22 |
| sp|Q37695|ATP9_YARLI | ATP synthase subunit 9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP9 PE=3 SV=1 | 77 | 145 | 1.0E-21 |
| sp|Q37315|ATP9_DICDI | ATP synthase subunit 9, mitochondrial OS=Dictyostelium discoideum GN=atp9 PE=3 SV=1 | 59 | 149 | 7.0E-21 |
| sp|Q2LCR3|ATP9_DICCI | ATP synthase subunit 9, mitochondrial OS=Dictyostelium citrinum GN=atp9 PE=3 SV=1 | 59 | 149 | 7.0E-21 |
| sp|Q01554|ATP9_TRIRU | ATP synthase subunit 9, mitochondrial OS=Trichophyton rubrum GN=ATP9 PE=3 SV=1 | 77 | 145 | 1.0E-20 |
| sp|Q71S46|AT5G3_RAT | ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus GN=Atp5g3 PE=2 SV=1 | 44 | 148 | 2.0E-20 |
| sp|P48201|AT5G3_HUMAN | ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens GN=ATP5G3 PE=2 SV=1 | 44 | 148 | 2.0E-20 |
| sp|Q06645|AT5G1_RAT | ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus GN=Atp5g1 PE=1 SV=1 | 24 | 148 | 2.0E-20 |
| sp|P17605|AT5G1_SHEEP | ATP synthase F(0) complex subunit C1, mitochondrial OS=Ovis aries GN=ATP5G1 PE=1 SV=2 | 39 | 148 | 3.0E-20 |
| sp|P56384|AT5G3_MOUSE | ATP synthase F(0) complex subunit C3, mitochondrial OS=Mus musculus GN=Atp5g3 PE=2 SV=1 | 22 | 148 | 3.0E-20 |
| sp|P32876|AT5G1_BOVIN | ATP synthase F(0) complex subunit C1, mitochondrial OS=Bos taurus GN=ATP5G1 PE=1 SV=1 | 39 | 148 | 3.0E-20 |
| sp|Q5RFL2|AT5G3_PONAB | ATP synthase F(0) complex subunit C3, mitochondrial OS=Pongo abelii GN=ATP5G3 PE=2 SV=1 | 44 | 148 | 4.0E-20 |
| sp|Q9CR84|AT5G1_MOUSE | ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus GN=Atp5g1 PE=2 SV=1 | 24 | 148 | 4.0E-20 |
| sp|Q3ZC75|AT5G3_BOVIN | ATP synthase F(0) complex subunit C3, mitochondrial OS=Bos taurus GN=ATP5G3 PE=2 SV=1 | 19 | 148 | 6.0E-20 |
| sp|P05496|AT5G1_HUMAN | ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens GN=ATP5G1 PE=1 SV=2 | 24 | 148 | 8.0E-20 |
| sp|Q5RAP9|AT5G2_PONAB | ATP synthase F(0) complex subunit C2, mitochondrial OS=Pongo abelii GN=ATP5G2 PE=2 SV=1 | 55 | 148 | 1.0E-19 |
| sp|A1XQS5|AT5G1_PIG | ATP synthase F(0) complex subunit C1, mitochondrial OS=Sus scrofa GN=ATP5G1 PE=2 SV=1 | 38 | 148 | 3.0E-19 |
| sp|P07926|AT5G2_BOVIN | ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus GN=ATP5G2 PE=1 SV=1 | 64 | 148 | 3.0E-19 |
| sp|Q06056|AT5G2_SHEEP | ATP synthase F(0) complex subunit C2, mitochondrial OS=Ovis aries GN=ATP5G2 PE=2 SV=1 | 64 | 148 | 3.0E-19 |
| sp|P56383|AT5G2_MOUSE | ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus GN=Atp5g2 PE=2 SV=2 | 64 | 148 | 4.0E-19 |
| sp|Q06055|AT5G2_HUMAN | ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens GN=ATP5G2 PE=2 SV=1 | 64 | 148 | 4.0E-19 |
| sp|Q9U505|AT5G_MANSE | ATP synthase lipid-binding protein, mitochondrial OS=Manduca sexta PE=2 SV=1 | 24 | 148 | 4.0E-19 |
| sp|Q06646|AT5G2_RAT | ATP synthase F(0) complex subunit C2, mitochondrial OS=Rattus norvegicus GN=Atp5g2 PE=2 SV=1 | 64 | 148 | 6.0E-19 |
| sp|P21537|ATP9_SCHPO | ATP synthase subunit 9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp9 PE=3 SV=3 | 77 | 148 | 7.0E-18 |
| sp|Q9BKS0|AT5G_CAEEL | ATP synthase lipid-binding protein, mitochondrial OS=Caenorhabditis elegans GN=Y82E9BR.3 PE=3 SV=1 | 34 | 148 | 9.0E-18 |
| sp|A8XDX2|AT5G_CAEBR | ATP synthase lipid-binding protein, mitochondrial OS=Caenorhabditis briggsae GN=CBG11706 PE=3 SV=1 | 34 | 148 | 9.0E-18 |
| sp|P48880|ATP9_CHOCR | ATP synthase subunit 9, mitochondrial OS=Chondrus crispus GN=ATP9 PE=3 SV=1 | 81 | 149 | 1.0E-17 |
| sp|A6H4Q2|ATP9_VANPO | ATP synthase subunit 9, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATP9 PE=3 SV=1 | 77 | 148 | 3.0E-17 |
| sp|P48881|ATP9_WICCA | ATP synthase subunit 9, mitochondrial OS=Wickerhamomyces canadensis GN=ATP9 PE=3 SV=1 | 77 | 145 | 6.0E-17 |
| sp|P61829|ATP9_YEAST | ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLI1 PE=1 SV=1 | 77 | 148 | 1.0E-16 |
| sp|P61828|ATP9_SACPA | ATP synthase subunit 9, mitochondrial OS=Saccharomyces paradoxus GN=ATP9 PE=3 SV=1 | 77 | 148 | 1.0E-16 |
| sp|P92811|ATP9_KLULA | ATP synthase subunit 9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP9 PE=3 SV=1 | 77 | 145 | 2.0E-16 |
| sp|Q75G38|ATP9_ASHGO | ATP synthase subunit 9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP9 PE=3 SV=1 | 77 | 145 | 2.0E-16 |
| sp|Q36852|ATP9_CYBMR | ATP synthase subunit 9, mitochondrial OS=Cyberlindnera mrakii GN=ATP9 PE=3 SV=1 | 77 | 144 | 4.0E-15 |
| sp|Q37377|ATP9_ACACA | ATP synthase subunit 9, mitochondrial OS=Acanthamoeba castellanii GN=ATP9 PE=3 SV=1 | 75 | 148 | 1.0E-14 |
| sp|Q9B8D5|ATP9_CANAL | ATP synthase subunit 9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP9 PE=3 SV=1 | 81 | 145 | 2.0E-14 |
| sp|A9RAH4|ATP9_DEBHA | ATP synthase subunit 9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATP9 PE=3 SV=1 | 81 | 145 | 3.0E-14 |
| sp|Q0BQY6|ATPL_GRABC | ATP synthase subunit c OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpE PE=3 SV=1 | 78 | 148 | 4.0E-14 |
| sp|Q3T4E5|ATP9_RHIOR | ATP synthase subunit 9, mitochondrial OS=Rhizopus oryzae GN=atp9 PE=3 SV=1 | 77 | 145 | 1.0E-13 |
| sp|P60112|ATP9_ARATH | ATP synthase subunit 9, mitochondrial OS=Arabidopsis thaliana GN=ATP9 PE=2 SV=2 | 66 | 149 | 3.0E-13 |
| sp|P60118|ATP9_PETHY | ATP synthase subunit 9, mitochondrial OS=Petunia hybrida GN=ATP9 PE=2 SV=1 | 98 | 149 | 1.0E-12 |
| sp|P60117|ATP9_SOLLC | ATP synthase subunit 9, mitochondrial OS=Solanum lycopersicum GN=ATP9 PE=3 SV=1 | 98 | 149 | 1.0E-12 |
| sp|P60116|ATP9_TOBAC | ATP synthase subunit 9, mitochondrial OS=Nicotiana tabacum GN=ATP9 PE=2 SV=1 | 98 | 149 | 1.0E-12 |
| sp|P26855|ATP9_MARPO | ATP synthase subunit 9, mitochondrial OS=Marchantia polymorpha GN=ATP9 PE=3 SV=2 | 98 | 149 | 2.0E-12 |
| sp|Q5FRW6|ATPL_GLUOX | ATP synthase subunit c OS=Gluconobacter oxydans (strain 621H) GN=atpE PE=3 SV=1 | 70 | 148 | 3.0E-12 |
| sp|P60114|ATP9_SOLTU | ATP synthase subunit 9, mitochondrial OS=Solanum tuberosum GN=ATP9 PE=2 SV=1 | 98 | 149 | 3.0E-12 |
| sp|P60115|ATP9_OENBI | ATP synthase subunit 9, mitochondrial OS=Oenothera biennis GN=ATP9 PE=2 SV=1 | 98 | 149 | 3.0E-12 |
| sp|Q12635|ATP9M_NEUCR | ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-9 PE=3 SV=1 | 77 | 145 | 3.0E-12 |
| sp|P15014|ATPL_RHORU | ATP synthase subunit c OS=Rhodospirillum rubrum GN=atpE PE=3 SV=1 | 79 | 148 | 4.0E-12 |
| sp|Q2RPA5|ATPL_RHORT | ATP synthase subunit c OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpE PE=3 SV=1 | 79 | 148 | 4.0E-12 |
| sp|P69422|ATP9_VICFA | ATP synthase subunit 9, mitochondrial OS=Vicia faba GN=ATP9 PE=3 SV=1 | 98 | 149 | 5.0E-12 |
| sp|P69421|ATP9_SOYBN | ATP synthase subunit 9, mitochondrial OS=Glycine max GN=ATP9 PE=3 SV=1 | 98 | 149 | 5.0E-12 |
| sp|P69420|ATP9_PEA | ATP synthase subunit 9, mitochondrial OS=Pisum sativum GN=ATP9 PE=3 SV=1 | 98 | 149 | 5.0E-12 |
| sp|Q2W027|ATPL_MAGSA | ATP synthase subunit c OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpE PE=3 SV=1 | 81 | 148 | 6.0E-12 |
| sp|P13547|ATP9_WHEAT | ATP synthase subunit 9, mitochondrial OS=Triticum aestivum GN=ATP9 PE=1 SV=3 | 98 | 149 | 7.0E-12 |
| sp|P00840|ATP9_MAIZE | ATP synthase subunit 9, mitochondrial OS=Zea mays GN=ATP9 PE=2 SV=2 | 98 | 149 | 7.0E-12 |
| sp|P0C518|ATP9_ORYSI | ATP synthase subunit 9, mitochondrial OS=Oryza sativa subsp. indica GN=ATP9 PE=3 SV=1 | 98 | 149 | 7.0E-12 |
| sp|P0C519|ATP9_ORYSJ | ATP synthase subunit 9, mitochondrial OS=Oryza sativa subsp. japonica GN=ATP9 PE=2 SV=1 | 98 | 149 | 7.0E-12 |
| sp|A9HDM8|ATPL_GLUDA | ATP synthase subunit c OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpE PE=3 SV=1 | 81 | 149 | 2.0E-11 |
| sp|P14571|ATP9_BETVU | ATP synthase subunit 9, mitochondrial OS=Beta vulgaris GN=ATP9 PE=3 SV=1 | 98 | 148 | 4.0E-11 |
| sp|Q85Q98|ATP9_CANGA | ATP synthase subunit 9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP9 PE=3 SV=1 | 101 | 148 | 1.0E-10 |
| sp|P60113|ATP9_BRANA | ATP synthase subunit 9, mitochondrial OS=Brassica napus GN=ATP9 PE=2 SV=1 | 77 | 149 | 3.0E-10 |
| sp|Q1RGZ2|ATPL_RICBR | ATP synthase subunit c OS=Rickettsia bellii (strain RML369-C) GN=atpE PE=3 SV=1 | 82 | 149 | 6.0E-10 |
| sp|A8GUJ2|ATPL_RICB8 | ATP synthase subunit c OS=Rickettsia bellii (strain OSU 85-389) GN=atpE PE=3 SV=1 | 82 | 149 | 6.0E-10 |
| sp|Q37550|ATP9_MALDO | ATP synthase subunit 9, mitochondrial OS=Malus domestica GN=ATP9 PE=3 SV=1 | 77 | 145 | 1.0E-09 |
| sp|A8EX89|ATPL_RICCK | ATP synthase subunit c OS=Rickettsia canadensis (strain McKiel) GN=atpE PE=3 SV=1 | 82 | 149 | 2.0E-09 |
| sp|C0R5U2|ATPL_WOLWR | ATP synthase subunit c OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpE PE=3 SV=1 | 82 | 148 | 6.0E-09 |
| sp|B3CLG2|ATPL_WOLPP | ATP synthase subunit c OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpE PE=3 SV=1 | 82 | 148 | 6.0E-09 |
| sp|Q73HW2|ATPL_WOLPM | ATP synthase subunit c OS=Wolbachia pipientis wMel GN=atpE PE=3 SV=1 | 82 | 148 | 6.0E-09 |
| sp|Q2GE12|ATPL_NEOSM | ATP synthase subunit c OS=Neorickettsia sennetsu (strain Miyayama) GN=atpE PE=3 SV=1 | 82 | 149 | 7.0E-09 |
| sp|Q07060|ATP9_PETSP | ATP synthase subunit 9, mitochondrial OS=Petunia sp. GN=ATP9 PE=3 SV=1 | 77 | 149 | 4.0E-08 |
| sp|P17254|ATP9_HELAN | ATP synthase subunit 9, mitochondrial OS=Helianthus annuus GN=ATP9 PE=3 SV=2 | 98 | 145 | 5.0E-08 |
| sp|Q9ZEC2|ATPL_RICPR | ATP synthase subunit c OS=Rickettsia prowazekii (strain Madrid E) GN=atpE PE=3 SV=1 | 82 | 149 | 7.0E-08 |
| sp|C3PM50|ATPL_RICAE | ATP synthase subunit c OS=Rickettsia africae (strain ESF-5) GN=atpE PE=3 SV=1 | 82 | 149 | 9.0E-08 |
| sp|C4K0P2|ATPL_RICPU | ATP synthase subunit c OS=Rickettsia peacockii (strain Rustic) GN=atpE PE=3 SV=1 | 82 | 149 | 1.0E-07 |
| sp|A8GLV9|ATPL_RICAH | ATP synthase subunit c OS=Rickettsia akari (strain Hartford) GN=atpE PE=3 SV=1 | 82 | 149 | 1.0E-07 |
| sp|Q92JP1|ATPL_RICCN | ATP synthase subunit c OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpE PE=3 SV=2 | 82 | 149 | 1.0E-07 |
| sp|Q4UNH9|ATPL_RICFE | ATP synthase subunit c OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpE PE=3 SV=1 | 82 | 149 | 1.0E-07 |
| sp|Q68XQ0|ATPL_RICTY | ATP synthase subunit c OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpE PE=3 SV=1 | 82 | 149 | 2.0E-07 |
| sp|A1SHI6|ATPL_NOCSJ | ATP synthase subunit c OS=Nocardioides sp. (strain BAA-499 / JS614) GN=atpE PE=3 SV=1 | 78 | 145 | 9.0E-07 |
| sp|B3CQT8|ATPL_ORITI | ATP synthase subunit c OS=Orientia tsutsugamushi (strain Ikeda) GN=atpE PE=3 SV=1 | 82 | 149 | 2.0E-06 |
| sp|A5CDC6|ATPL_ORITB | ATP synthase subunit c OS=Orientia tsutsugamushi (strain Boryong) GN=atpE PE=3 SV=1 | 82 | 149 | 2.0E-06 |
| sp|Q0C0X2|ATPL_HYPNA | ATP synthase subunit c OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpE PE=3 SV=1 | 82 | 149 | 2.0E-06 |
| sp|Q4L7Y9|ATPL_STAHJ | ATP synthase subunit c OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpE PE=3 SV=1 | 90 | 148 | 3.0E-06 |
| sp|Q4A8W4|ATPL_MYCH7 | ATP synthase subunit c OS=Mycoplasma hyopneumoniae (strain 7448) GN=atpE PE=3 SV=1 | 52 | 149 | 3.0E-06 |
| sp|B9DME9|ATPL_STACT | ATP synthase subunit c OS=Staphylococcus carnosus (strain TM300) GN=atpE PE=3 SV=1 | 83 | 148 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0015078 | proton transmembrane transporter activity | Yes |
| GO:1902600 | proton transmembrane transport | Yes |
| GO:0033177 | proton-transporting two-sector ATPase complex, proton-transporting domain | Yes |
| GO:0051179 | localization | No |
| GO:0098662 | inorganic cation transmembrane transport | No |
| GO:0006810 | transport | No |
| GO:0009987 | cellular process | No |
| GO:0008324 | cation transmembrane transporter activity | No |
| GO:0098655 | cation transmembrane transport | No |
| GO:0034220 | ion transmembrane transport | No |
| GO:0051234 | establishment of localization | No |
| GO:0098796 | membrane protein complex | No |
| GO:0032991 | protein-containing complex | No |
| GO:0006811 | ion transport | No |
| GO:0006812 | cation transport | No |
| GO:0098660 | inorganic ion transmembrane transport | No |
| GO:0015075 | ion transmembrane transporter activity | No |
| GO:0055085 | transmembrane transport | No |
| GO:0005575 | cellular_component | No |
| GO:0022890 | inorganic cation transmembrane transporter activity | No |
| GO:0003674 | molecular_function | No |
| GO:0008150 | biological_process | No |
| GO:0005215 | transporter activity | No |
| GO:0015318 | inorganic molecular entity transmembrane transporter activity | No |
| GO:0022857 | transmembrane transporter activity | No |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 86 | 108 | 22 |
| 2 | 121 | 143 | 22 |
| Orthofinder run ID | 4 |
| Orthogroup | 2118 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|3297 MAAARVFASRLASQMGSRAARPALRAPVAASARRSLTASAGPLQALRRQQANSLLQASRNVVRFQRRAYSSEIAQ AMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNAVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFT* |
| Coding | >Ophun1|3297 ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAG GCCAACAGCTTGCTCCAGGCGAGCCGGAATGTCGTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAG GCCATGGTCGAGGTCTCCAAGAACCTGGGCATGGGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATC GGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTGGCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCC ATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGTCTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTACCTAA |
| Transcript | >Ophun1|3297 ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAG GCCAACAGCTTGCTCCAGGCGAGCCGGAATGTCGTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAG GCCATGGTCGAGGTCTCCAAGAACCTGGGCATGGGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATC GGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTGGCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCC ATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGTCTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTACCTAA |
| Gene | >Ophun1|3297 ATGGCCGCTGCTCGTGTCTTCGCCTCGCGTCTGGCTTCGCAGATGGGCTCTAGGGCTGCTCGTCCGGCTTTGAGG GCTCCTGTTGCCGCTTCGGCTCGGCGGTCTTTGACTGGTATGGTGAAGCGCGAGAAAAGTTTTTTCTTGCTGTCC TTTTCGTCTCCTGAAGCTCCCCCCGAGCTCCTCTTGGTCCATACTCGCTGTCCAACACCTCACTGACGCCCCCAT TCAGCTTCCGCCGGGCCCCTTCAAGCTCTCCGCCGCCAGCAGGCCAACAGCTTGCTCCAGGCGAGCCGGAATGTC GTCCGGTTCCAGCGTCGGGCTTACTCGTCCGAGATTGCCCAGGCCATGGTCGAGGTCTCCAAGAACCTGGGCATG GGCTCTGCCGCCATCGGTCTGACGGGAGCCGGTATCGGTATCGGTCTCGTCTTCGCCGCCCTGCTCAATGCCGTG GCTCGCAATCCTGCTCTCCGCGGCCAGCTCTTCTCGTACGCCATTCTGGGCTTTGCCTTTGTCGAGGCCATCGGT CTCTTTGACTTGATGGTTGCCCTCATGGCCAAGTTTGTGCGTACCAACCTGGTTGCTTCTCGTCGAATGACACGT CTGACACGCTGGTAGACCTAA |