Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3296
Gene name
LocationContig_293:16697..19403
Strand+
Gene length (bp)2706
Transcript length (bp)2490
Coding sequence length (bp)2490
Protein length (aa) 830

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 1.1E-43 230 397
PF08066 PMC2NT PMC2NT (NUC016) domain 2.8E-24 19 117
PF00570 HRDC HRDC domain 1.2E-10 457 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10146|RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp6 PE=3 SV=2 16 527 1.0E-111
sp|Q12149|RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP6 PE=1 SV=1 18 694 4.0E-104
sp|P56960|EXOSX_MOUSE Exosome component 10 OS=Mus musculus GN=Exosc10 PE=1 SV=2 60 827 8.0E-80
sp|Q01780|EXOSX_HUMAN Exosome component 10 OS=Homo sapiens GN=EXOSC10 PE=1 SV=2 5 528 1.0E-79
sp|A9LLI7|RP6L2_ARATH Protein RRP6-like 2 OS=Arabidopsis thaliana GN=RRP6L2 PE=2 SV=1 86 508 3.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10146|RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp6 PE=3 SV=2 16 527 1.0E-111
sp|Q12149|RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP6 PE=1 SV=1 18 694 4.0E-104
sp|P56960|EXOSX_MOUSE Exosome component 10 OS=Mus musculus GN=Exosc10 PE=1 SV=2 60 827 8.0E-80
sp|Q01780|EXOSX_HUMAN Exosome component 10 OS=Homo sapiens GN=EXOSC10 PE=1 SV=2 5 528 1.0E-79
sp|A9LLI7|RP6L2_ARATH Protein RRP6-like 2 OS=Arabidopsis thaliana GN=RRP6L2 PE=2 SV=1 86 508 3.0E-63
sp|Q0WVE8|RP6L1_ARATH Protein RRP6-like 1 OS=Arabidopsis thaliana GN=RRP6L1 PE=2 SV=1 181 508 2.0E-62
sp|A9LLI8|RP6L3_ARATH Protein RRP6-like 3 OS=Arabidopsis thaliana GN=RRP6L3 PE=2 SV=1 197 508 2.0E-42
sp|B8EN54|RND_METSB Ribonuclease D OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rnd PE=3 SV=2 232 588 2.0E-13
sp|Q0BVP4|RND_GRABC Ribonuclease D OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rnd PE=3 SV=2 228 397 8.0E-13
sp|A9H9B7|RND_GLUDA Ribonuclease D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rnd PE=3 SV=1 232 397 4.0E-12
sp|Q28RA7|RND_JANSC Ribonuclease D OS=Jannaschia sp. (strain CCS1) GN=rnd PE=3 SV=1 251 401 8.0E-12
sp|A5G127|RND_ACICJ Ribonuclease D OS=Acidiphilium cryptum (strain JF-5) GN=rnd PE=3 SV=1 218 399 2.0E-11
sp|C6C608|RND_DICDC Ribonuclease D OS=Dickeya dadantii (strain Ech703) GN=rnd PE=3 SV=2 232 505 3.0E-11
sp|A7HYE5|RND_PARL1 Ribonuclease D OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rnd PE=3 SV=2 245 505 2.0E-10
sp|Q6G329|RND_BARHE Ribonuclease D OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnd PE=3 SV=1 242 400 8.0E-10
sp|C9XUE4|RND_SICTZ Ribonuclease D OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=rnd PE=3 SV=2 232 505 1.0E-09
sp|Q1QLI8|RND_NITHX Ribonuclease D OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rnd PE=3 SV=2 251 399 2.0E-09
sp|P09155|RND_ECOLI Ribonuclease D OS=Escherichia coli (strain K12) GN=rnd PE=1 SV=1 232 505 2.0E-09
sp|Q5NPM2|RND_ZYMMO Ribonuclease D OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnd PE=3 SV=1 222 397 3.0E-09
sp|P44442|RND_HAEIN Ribonuclease D OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnd PE=3 SV=1 237 528 5.0E-09
sp|A6V8R6|RND_PSEA7 Ribonuclease D OS=Pseudomonas aeruginosa (strain PA7) GN=rnd PE=3 SV=2 231 510 7.0E-09
sp|D4Z694|RND_SPHJU Ribonuclease D OS=Sphingobium japonicum (strain NBRC 101211 / UT26S) GN=rnd PE=3 SV=2 245 400 6.0E-08
sp|A8GFH0|RND_SERP5 Ribonuclease D OS=Serratia proteamaculans (strain 568) GN=rnd PE=3 SV=2 232 505 1.0E-07
sp|O67779|DPO1_AQUAE DNA polymerase I OS=Aquifex aeolicus (strain VF5) GN=polA PE=3 SV=1 231 401 1.0E-07
sp|Q5GZ75|RND_XANOR Ribonuclease D OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnd PE=3 SV=2 231 401 3.0E-06
sp|Q6AJF4|RND_DESPS Ribonuclease D OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rnd PE=3 SV=1 232 386 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0000176 nuclear exosome (RNase complex) Yes
GO:0003676 nucleic acid binding Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006396 RNA processing Yes
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0000178 exosome (RNase complex) No
GO:0044237 cellular metabolic process No
GO:0004527 exonuclease activity No
GO:0090304 nucleic acid metabolic process No
GO:1905354 exoribonuclease complex No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0004518 nuclease activity No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4151
Ophiocordyceps australis map64 (Brazil) OphauB2|6589
Ophiocordyceps camponoti-floridani Ophcf2|05188
Ophiocordyceps camponoti-rufipedis Ophun1|3296 (this protein)
Ophiocordyceps kimflemingae Ophio5|3716
Ophiocordyceps subramaniannii Hirsu2|2520

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3296
MEDAPDFESQQKRIQKSLVSTVKTVNRLAAEDLQFQRTVNPDTARQLDESASRALDLSTRLLQAAARACKVQAKG
KAKEPAPKIEDVEDIDLKWPSIVDVVDSVLEKADTALDEFTGLIKRKEPVPAEQTPTSRKPTGKVIRNADVSKPQ
LLFEKKPDNFPTEPWKPILTTKPHAIISLSQSLVLSPREDGTLQYKHPYEHEITNMQYPDRLFEIVDPIPSQPVE
TTSATWVDTYDGVLDMLKELKKADEIAVDLEHHDFRTYTGLVCLMQISTREKDWIVDTLQPWRHKLEILNEVFAD
PKIIKVFHGAYMDMVWLQRDLGLYVNGLFDTFFASNILNFPSRSLAFLLSKYANFSADKQYQLADWRIRPIPPEM
MYYARSDTHYLLHIFDQLRNELCKSDLANPGAGYTRDALERSRELALSRHEHPDFDHETGRGSRGWYNYVLKQAH
LGFDSQQFAVFRAMWQWRDAVAREEDENPNFVLGTNQILSIVRVNPPDVKALHGMLPYTASLARARFTELWERIR
DAKAQGGPSLLKFFSSQTSEVARKPAAKPATVVKTPVTSEQSDAKVTSLKQSQLFGDMAISTRWEAGGHENDGPQ
DSLPFPWQRFVEGSVEAGDAGGDEKTPEEVQTENAGETETAQAKGDDAMEAVQEAEDAAAEMTVEVASQAADDKD
DEVILKRGKKRKSKAVEDKEESSAEQSEAKGEADEADDGVLRMDEDEELSDSKKASKKKRRKENEGKTHKAHKKT
QRREERRSRKVKKRQQRQQQADEAPFDYSKAASVLHAGQGSSRERAKVFDPYAKTADDGLKGARKAPPVRGERSA
TFKG*
Coding >Ophun1|3296
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAGCGGATTCAAAAGTCTCTCGTCTCGACGGTCAAGACGGTT
AATCGTCTCGCCGCTGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTCGACGAAAGC
GCCTCTCGAGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCTCGCGCGTGCAAGGTGCAGGCGAAGGGC
AAGGCGAAGGAGCCGGCGCCCAAGATTGAGGATGTCGAGGACATTGATCTCAAGTGGCCGTCCATCGTCGACGTT
GTTGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGATGAGTTCACGGGCTTGATTAAGCGCAAGGAACCCGTG
CCGGCAGAACAGACACCGACTTCTAGGAAACCTACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAG
CTACTATTCGAGAAGAAGCCGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTTACGACGAAGCCGCATGCC
ATTATATCTCTATCCCAGAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAATACAAGCATCCTTACGAG
CATGAGATTACCAATATGCAATACCCAGACCGATTATTCGAGATTGTCGACCCGATTCCTTCTCAGCCAGTTGAG
ACGACATCAGCCACATGGGTAGACACGTACGACGGCGTCTTGGACATGCTGAAAGAGCTAAAAAAGGCAGACGAA
ATAGCCGTCGACCTGGAGCATCACGACTTTCGAACCTACACTGGCCTCGTCTGCTTGATGCAGATCAGCACGCGC
GAAAAAGACTGGATAGTCGACACGCTGCAGCCCTGGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGAT
CCAAAGATTATCAAGGTCTTCCATGGTGCCTACATGGACATGGTGTGGTTGCAGCGAGACCTTGGCTTATACGTC
AACGGTCTCTTCGATACCTTTTTCGCCAGCAATATACTCAACTTTCCTAGCAGAAGCCTTGCTTTTCTTCTGTCC
AAGTATGCCAACTTTAGCGCGGACAAGCAGTATCAGCTGGCCGATTGGAGAATTCGGCCGATTCCCCCGGAAATG
ATGTATTACGCCCGATCCGATACCCATTACCTCTTGCACATATTCGATCAACTGCGAAATGAGCTCTGTAAGAGC
GACCTTGCGAACCCGGGCGCCGGCTACACCAGGGATGCTCTCGAACGATCCCGGGAGCTGGCGCTCTCTCGCCAC
GAACACCCCGATTTCGACCACGAGACGGGCAGAGGATCGCGTGGCTGGTACAACTACGTCCTGAAGCAGGCTCAC
CTCGGGTTCGACAGCCAGCAGTTTGCCGTCTTCCGGGCCATGTGGCAGTGGAGGGATGCTGTGGCTCGGGAAGAA
GACGAGAACCCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCGCCGGACGTCAAG
GCCCTGCATGGCATGCTCCCGTACACGGCTTCTCTGGCCAGAGCCCGGTTCACGGAACTGTGGGAGCGGATCCGG
GATGCCAAGGCGCAGGGCGGACCGTCGCTGCTCAAGTTCTTTTCGTCTCAGACTTCAGAGGTGGCGCGGAAACCA
GCAGCGAAGCCTGCGACTGTGGTAAAGACGCCGGTGACATCGGAGCAGAGCGACGCCAAGGTTACGAGCCTGAAG
CAATCACAGCTCTTTGGAGACATGGCGATAAGCACGCGATGGGAGGCTGGGGGTCATGAAAACGATGGCCCCCAA
GACAGCTTACCCTTTCCTTGGCAACGGTTCGTGGAGGGCTCAGTCGAGGCAGGCGACGCAGGTGGCGATGAGAAG
ACCCCTGAGGAGGTACAAACGGAGAATGCCGGCGAAACTGAGACAGCACAAGCGAAGGGTGACGATGCCATGGAG
GCAGTACAAGAGGCCGAGGACGCTGCAGCGGAGATGACAGTCGAGGTGGCATCCCAGGCGGCAGATGACAAGGAC
GACGAGGTTATACTGAAGAGAGGAAAAAAACGGAAGTCAAAGGCGGTCGAGGACAAGGAAGAGTCGAGCGCAGAG
CAATCAGAGGCCAAGGGAGAGGCGGACGAGGCGGACGACGGAGTGCTGCGCATGGACGAAGATGAAGAGCTCTCC
GACAGCAAGAAGGCGTCGAAAAAGAAGCGTCGAAAGGAAAACGAGGGCAAGACCCATAAGGCCCATAAGAAGACG
CAGAGGCGAGAAGAGCGCAGGTCAAGGAAGGTCAAGAAGAGGCAGCAGAGACAGCAGCAGGCTGACGAGGCTCCG
TTCGACTACAGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCATCCCGTGAGCGGGCCAAGGTGTTTGAT
CCGTACGCGAAGACGGCGGACGATGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTGCGGGGGGAGAGGAGCGCG
ACGTTTAAGGGGTAG
Transcript >Ophun1|3296
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAGCGGATTCAAAAGTCTCTCGTCTCGACGGTCAAGACGGTT
AATCGTCTCGCCGCTGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTCGACGAAAGC
GCCTCTCGAGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCTCGCGCGTGCAAGGTGCAGGCGAAGGGC
AAGGCGAAGGAGCCGGCGCCCAAGATTGAGGATGTCGAGGACATTGATCTCAAGTGGCCGTCCATCGTCGACGTT
GTTGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGATGAGTTCACGGGCTTGATTAAGCGCAAGGAACCCGTG
CCGGCAGAACAGACACCGACTTCTAGGAAACCTACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAG
CTACTATTCGAGAAGAAGCCGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTTACGACGAAGCCGCATGCC
ATTATATCTCTATCCCAGAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAATACAAGCATCCTTACGAG
CATGAGATTACCAATATGCAATACCCAGACCGATTATTCGAGATTGTCGACCCGATTCCTTCTCAGCCAGTTGAG
ACGACATCAGCCACATGGGTAGACACGTACGACGGCGTCTTGGACATGCTGAAAGAGCTAAAAAAGGCAGACGAA
ATAGCCGTCGACCTGGAGCATCACGACTTTCGAACCTACACTGGCCTCGTCTGCTTGATGCAGATCAGCACGCGC
GAAAAAGACTGGATAGTCGACACGCTGCAGCCCTGGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGAT
CCAAAGATTATCAAGGTCTTCCATGGTGCCTACATGGACATGGTGTGGTTGCAGCGAGACCTTGGCTTATACGTC
AACGGTCTCTTCGATACCTTTTTCGCCAGCAATATACTCAACTTTCCTAGCAGAAGCCTTGCTTTTCTTCTGTCC
AAGTATGCCAACTTTAGCGCGGACAAGCAGTATCAGCTGGCCGATTGGAGAATTCGGCCGATTCCCCCGGAAATG
ATGTATTACGCCCGATCCGATACCCATTACCTCTTGCACATATTCGATCAACTGCGAAATGAGCTCTGTAAGAGC
GACCTTGCGAACCCGGGCGCCGGCTACACCAGGGATGCTCTCGAACGATCCCGGGAGCTGGCGCTCTCTCGCCAC
GAACACCCCGATTTCGACCACGAGACGGGCAGAGGATCGCGTGGCTGGTACAACTACGTCCTGAAGCAGGCTCAC
CTCGGGTTCGACAGCCAGCAGTTTGCCGTCTTCCGGGCCATGTGGCAGTGGAGGGATGCTGTGGCTCGGGAAGAA
GACGAGAACCCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCGCCGGACGTCAAG
GCCCTGCATGGCATGCTCCCGTACACGGCTTCTCTGGCCAGAGCCCGGTTCACGGAACTGTGGGAGCGGATCCGG
GATGCCAAGGCGCAGGGCGGACCGTCGCTGCTCAAGTTCTTTTCGTCTCAGACTTCAGAGGTGGCGCGGAAACCA
GCAGCGAAGCCTGCGACTGTGGTAAAGACGCCGGTGACATCGGAGCAGAGCGACGCCAAGGTTACGAGCCTGAAG
CAATCACAGCTCTTTGGAGACATGGCGATAAGCACGCGATGGGAGGCTGGGGGTCATGAAAACGATGGCCCCCAA
GACAGCTTACCCTTTCCTTGGCAACGGTTCGTGGAGGGCTCAGTCGAGGCAGGCGACGCAGGTGGCGATGAGAAG
ACCCCTGAGGAGGTACAAACGGAGAATGCCGGCGAAACTGAGACAGCACAAGCGAAGGGTGACGATGCCATGGAG
GCAGTACAAGAGGCCGAGGACGCTGCAGCGGAGATGACAGTCGAGGTGGCATCCCAGGCGGCAGATGACAAGGAC
GACGAGGTTATACTGAAGAGAGGAAAAAAACGGAAGTCAAAGGCGGTCGAGGACAAGGAAGAGTCGAGCGCAGAG
CAATCAGAGGCCAAGGGAGAGGCGGACGAGGCGGACGACGGAGTGCTGCGCATGGACGAAGATGAAGAGCTCTCC
GACAGCAAGAAGGCGTCGAAAAAGAAGCGTCGAAAGGAAAACGAGGGCAAGACCCATAAGGCCCATAAGAAGACG
CAGAGGCGAGAAGAGCGCAGGTCAAGGAAGGTCAAGAAGAGGCAGCAGAGACAGCAGCAGGCTGACGAGGCTCCG
TTCGACTACAGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCATCCCGTGAGCGGGCCAAGGTGTTTGAT
CCGTACGCGAAGACGGCGGACGATGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTGCGGGGGGAGAGGAGCGCG
ACGTTTAAGGGGTAG
Gene >Ophun1|3296
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAGCGGATTCAAAAGTCTCTCGTCTCGACGGTCAAGACGGTT
AATCGTCTCGCCGCTGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTCGACGAAAGC
GCCTCTCGAGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCTCGCGCGTGCAAGGTGCAGGCGAAGGGC
AAGGCGAAGGAGCCGGCGCCCAAGATTGAGGATGTCGAGGACATTGATCTCAAGTGGCCGTCCATCGTCGACGTT
GTTGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGATGAGTTCACGGGCTTGATTAAGCGCAAGGAACCCGTG
CCGGCAGAACAGGTTGGCGCTCATACCCCCATCTTTGAAAATTGTAGTCCTTCTGACACGATATTTGCAGACACC
GACTTCTAGGAAACCTACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAGCTACTATTCGAGAAGAA
GCCGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTTACGACGAAGCCGCATGCCATTATATCTCTATCCCA
GAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAGTGGGTCCAACAGTCCTTCTCTGCGTGCAAGAATCT
GAGCTGACAGCGGCTATCCCAGATACAAGCATCCTTACGAGCATGAGATTACCAATATGCAATACCCAGACCGAT
TATTCGAGATTGTCGACCCGATTCCTTCTCAGCCAGTTGAGACGACATCAGCCACATGGGTAGACACGTACGACG
GCGTCTTGGACATGCTGAAAGAGCTAAAAAAGGCAGACGAAATAGCCGTCGACCTGGAGCATCACGACTTTCGAA
CCTACACTGGCCTCGTCTGCTTGATGCAGATCAGCACGCGCGAAAAAGACTGGATAGTCGACACGCTGCAGCCCT
GGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGATCCAAAGATTATCAAGGTAAGTTTTACCGTAAGAG
CACTGGACCAGGCTCAACCTCTGACATTCGCCAGGTCTTCCATGGTGCCTACATGGACATGGTGTGGTTGCAGCG
AGACCTTGGCTTATACGTCAACGGTCTCTTCGATACCTTTTTCGCCAGCAATATACTCAACTTTCCTAGCAGAAG
CCTTGCTTTTCTTCTGTCCAAGTATGCCAACTTTAGCGCGGACAAGCAGTATCAGCTGGCCGATTGGAGAATTCG
GTTCGTGTCCTTGCCCGAAGACGGCGTGCCTGGCTAACGTGTGCTAGGCCGATTCCCCCGGAAATGATGTATTAC
GCCCGATCCGATACCCATTACCTCTTGCACATATTCGATCAACTGCGAAATGAGCTCTGTAAGAGCGACCTTGCG
AACCCGGGCGCCGGCTACACCAGGGATGCTCTCGAACGATCCCGGGAGCTGGCGCTCTCTCGCCACGAACACCCC
GATTTCGACCACGAGACGGGCAGAGGATCGCGTGGCTGGTACAACTACGTCCTGAAGCAGGCTCACCTCGGGTTC
GACAGCCAGCAGTTTGCCGTCTTCCGGGCCATGTGGCAGTGGAGGGATGCTGTGGCTCGGGAAGAAGACGAGAAC
CCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCGCCGGACGTCAAGGCCCTGCAT
GGCATGCTCCCGTACACGGCTTCTCTGGCCAGAGCCCGGTTCACGGAACTGTGGGAGCGGATCCGGGATGCCAAG
GCGCAGGGCGGACCGTCGCTGCTCAAGTTCTTTTCGTCTCAGACTTCAGAGGTGGCGCGGAAACCAGCAGCGAAG
CCTGCGACTGTGGTAAAGACGCCGGTGACATCGGAGCAGAGCGACGCCAAGGTTACGAGCCTGAAGCAATCACAG
CTCTTTGGAGACATGGCGATAAGCACGCGATGGGAGGCTGGGGGTCATGAAAACGATGGCCCCCAAGACAGCTTA
CCCTTTCCTTGGCAACGGTTCGTGGAGGGCTCAGTCGAGGCAGGCGACGCAGGTGGCGATGAGAAGACCCCTGAG
GAGGTACAAACGGAGAATGCCGGCGAAACTGAGACAGCACAAGCGAAGGGTGACGATGCCATGGAGGCAGTACAA
GAGGCCGAGGACGCTGCAGCGGAGATGACAGTCGAGGTGGCATCCCAGGCGGCAGATGACAAGGACGACGAGGTT
ATACTGAAGAGAGGAAAAAAACGGAAGTCAAAGGCGGTCGAGGACAAGGAAGAGTCGAGCGCAGAGCAATCAGAG
GCCAAGGGAGAGGCGGACGAGGCGGACGACGGAGTGCTGCGCATGGACGAAGATGAAGAGCTCTCCGACAGCAAG
AAGGCGTCGAAAAAGAAGCGTCGAAAGGAAAACGAGGGCAAGACCCATAAGGCCCATAAGAAGACGCAGAGGCGA
GAAGAGCGCAGGTCAAGGAAGGTCAAGAAGAGGCAGCAGAGACAGCAGCAGGCTGACGAGGCTCCGTTCGACTAC
AGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCATCCCGTGAGCGGGCCAAGGTGTTTGATCCGTACGCG
AAGACGGCGGACGATGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTGCGGGGGGAGAGGAGCGCGACGTTTAAG
GGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail