Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3285
Gene name
LocationContig_292:11394..13316
Strand+
Gene length (bp)1922
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 2.5E-196 53 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1C5W7|AT222_ASPCL Autophagy-related protein 22-2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-2 PE=3 SV=1 44 593 0.0E+00
sp|Q2HFE0|ATG22_CHAGB Autophagy-related protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG22 PE=3 SV=2 18 614 0.0E+00
sp|A1DI95|AT222_NEOFI Autophagy-related protein 22-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-2 PE=3 SV=1 43 609 0.0E+00
sp|Q4WH97|AT221_ASPFU Autophagy-related protein 22-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-1 PE=3 SV=1 43 593 0.0E+00
sp|Q1E8Z0|ATG22_COCIM Autophagy-related protein 22 OS=Coccidioides immitis (strain RS) GN=ATG22 PE=3 SV=3 44 616 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1C5W7|AT222_ASPCL Autophagy-related protein 22-2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-2 PE=3 SV=1 44 593 0.0E+00
sp|Q2HFE0|ATG22_CHAGB Autophagy-related protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG22 PE=3 SV=2 18 614 0.0E+00
sp|A1DI95|AT222_NEOFI Autophagy-related protein 22-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-2 PE=3 SV=1 43 609 0.0E+00
sp|Q4WH97|AT221_ASPFU Autophagy-related protein 22-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-1 PE=3 SV=1 43 593 0.0E+00
sp|Q1E8Z0|ATG22_COCIM Autophagy-related protein 22 OS=Coccidioides immitis (strain RS) GN=ATG22 PE=3 SV=3 44 616 0.0E+00
sp|A2QFJ9|AT221_ASPNC Autophagy-related protein 22-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-1 PE=3 SV=2 25 594 0.0E+00
sp|A1DG37|AT221_NEOFI Autophagy-related protein 22-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-1 PE=3 SV=1 43 593 0.0E+00
sp|Q2UMJ2|AT221_ASPOR Autophagy-related protein 22-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-1 PE=3 SV=1 34 594 0.0E+00
sp|Q5AW93|AT221_EMENI Autophagy-related protein 22-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-1 PE=3 SV=2 35 604 0.0E+00
sp|Q0CL24|AT222_ASPTN Autophagy-related protein 22-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-2 PE=3 SV=1 41 594 0.0E+00
sp|Q0U103|AT222_PHANO Autophagy-related protein 22-2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-2 PE=3 SV=2 16 619 0.0E+00
sp|A7KAM9|AT221_PENRW Autophagy-related protein 22-1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-1 PE=3 SV=1 34 594 0.0E+00
sp|A6S3R7|AT222_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=ATG22 PE=3 SV=2 18 620 0.0E+00
sp|A7EXE6|AT222_SCLS1 Autophagy-related protein 22-2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-2 PE=3 SV=1 2 612 0.0E+00
sp|Q51IZ9|ATG22_MAGO7 Autophagy-related protein 22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG22 PE=3 SV=1 25 616 0.0E+00
sp|Q7SG38|ATG22_NEUCR Autophagy-related protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-11 PE=3 SV=1 15 597 0.0E+00
sp|A1C7M3|AT221_ASPCL Autophagy-related protein 22-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-1 PE=3 SV=1 42 621 1.0E-179
sp|Q5AVT9|AT222_EMENI Autophagy-related protein 22-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-2 PE=3 SV=1 44 608 8.0E-178
sp|Q0CEJ5|AT221_ASPTN Autophagy-related protein 22-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-1 PE=3 SV=2 33 609 4.0E-177
sp|Q2UD74|AT222_ASPOR Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-2 PE=3 SV=2 43 619 4.0E-175
sp|A7KAN0|AT222_PENRW Autophagy-related protein 22-2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-2 PE=3 SV=1 43 609 1.0E-174
sp|Q4WZY1|AT222_ASPFU Autophagy-related protein 22-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-2 PE=3 SV=1 43 609 1.0E-174
sp|A7E7N1|AT221_SCLS1 Autophagy-related protein 22-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-1 PE=3 SV=1 38 612 1.0E-172
sp|A6SSM3|AT221_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=atg22 PE=3 SV=1 38 612 1.0E-171
sp|A2QTX8|AT222_ASPNC Autophagy-related protein 22-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-2 PE=3 SV=1 42 589 4.0E-166
sp|Q0TWF4|AT221_PHANO Autophagy-related protein 22-1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-1 PE=3 SV=2 42 589 4.0E-143
sp|Q6CD56|ATG22_YARLI Autophagy-related protein 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG22 PE=3 SV=1 49 593 7.0E-116
sp|A7KAK4|ATG22_PICAN Autophagy-related protein 22 OS=Pichia angusta GN=ATG22 PE=3 SV=1 53 594 7.0E-94
sp|Q6FX92|ATG22_CANGA Autophagy-related protein 22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG22 PE=3 SV=1 45 589 8.0E-91
sp|Q751W1|ATG22_ASHGO Autophagy-related protein 22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG22 PE=3 SV=1 49 593 4.0E-89
sp|A7TFA9|ATG22_VANPO Autophagy-related protein 22 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG22 PE=3 SV=1 54 588 2.0E-85
sp|A6ZTF2|ATG22_YEAS7 Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG22 PE=3 SV=1 54 589 1.0E-82
sp|P25568|ATG22_YEAST Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG22 PE=1 SV=1 54 589 2.0E-82
sp|P0CM32|ATG22_CRYNJ Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG22 PE=3 SV=1 60 585 5.0E-60
sp|P0CM33|ATG22_CRYNB Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG22 PE=3 SV=1 60 585 5.0E-60
sp|Q6CUZ1|ATG22_KLULA Autophagy-related protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG22 PE=3 SV=1 279 589 5.0E-56
sp|Q09812|ATG22_SCHPO Autophagy-related protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg22 PE=3 SV=1 57 576 4.0E-41
sp|Q6CUZ1|ATG22_KLULA Autophagy-related protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG22 PE=3 SV=1 54 239 4.0E-23
sp|Q5A6K2|ATG22_CANAL Autophagy-related protein 22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG22 PE=3 SV=1 459 587 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 127 149 22
3 162 181 19
4 185 207 22
5 296 318 22
6 328 347 19
7 389 411 22
8 421 443 22
9 456 478 22
10 493 515 22
11 527 549 22
12 559 576 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3285
MPSPAVCPKPPLEVRSGSSDEADDERSDSDAEMMMASSGVPSPRYSGYDARPTSRKELFGWYMYAFAAETYVICG
IASFIPILLESLARENGVLLSDPTKPCGSSDSKTDNDDGQCVVYVLGLQINTASFAMYTFSLSVALQALLVVSIS
CAADHGNYRKKLLLAFAWIGALAVMSYIFIGKETYILGAVLTIISNTSFGASFVLLNSFLPLLVRNHPDVIGARG
THTPDLAATVLESRPLEDSVGELETPAMASSTSALLPDDEESAAWPLKRDAVPEDMTSKELQLSTRLSAQGIGVG
YSAGLFVQCISIAILIWMKNTTWAQRVVLFFVGTWWCLFTIPAALWLRPRPGPPLTGDGSLSWISYLTYAWKSLW
RTVKLLRRLVDIALFLAGWFLLSDAIATTSSTAILFAKTHLHMPPWALGMINVIVTLTGVLGAFGWSWVSRIWGI
QAHQTILVCIGLFELIPLYGLLGYIPFIEQWGVIGLQRPWEMYLLAAIYGLVMGGLSSYCRSLYGELIPPGSEAA
FYALYAITDKGSSVFGPTIVGAIIDRTGSIRPAFWFLAVLVSLPAPLIWFIDVERGKREADRLAGTIEGFTVAGT
GDEGRGMMADYDGDGQLRRRP*
Coding >Ophun1|3285
ATGCCATCGCCAGCCGTCTGTCCCAAGCCCCCGCTCGAAGTCCGCTCCGGTTCCTCGGACGAGGCCGACGACGAG
CGCTCCGACTCGGATGCTGAGATGATGATGGCTTCCTCTGGGGTCCCGTCTCCGCGATACTCGGGCTATGATGCG
CGTCCCACCAGTCGCAAAGAGCTGTTTGGCTGGTACATGTATGCCTTCGCCGCCGAGACGTATGTCATCTGCGGC
ATCGCCTCCTTCATACCCATCCTTCTCGAATCGCTGGCGCGCGAAAACGGCGTGCTACTCTCCGACCCGACCAAA
CCATGCGGTTCCAGCGATAGCAAGACGGATAATGACGACGGCCAGTGCGTCGTCTACGTTCTCGGCCTGCAGATC
AACACGGCCAGCTTCGCCATGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTCGTCAGCATCAGC
TGCGCCGCCGACCACGGCAACTACCGCAAGAAGCTTCTTCTGGCTTTCGCCTGGATAGGCGCCTTGGCTGTCATG
TCGTACATCTTTATCGGAAAGGAGACGTACATCCTCGGTGCCGTCCTGACCATTATATCCAACACGTCTTTCGGC
GCGTCGTTTGTCCTGCTCAATTCTTTTTTGCCGCTGCTGGTGAGGAATCATCCCGATGTTATCGGCGCACGGGGC
ACGCATACGCCTGATCTGGCGGCCACGGTGCTTGAATCGCGTCCGCTGGAGGATTCGGTCGGCGAGTTGGAGACG
CCGGCCATGGCGAGCTCTACCTCGGCGCTGTTGCCCGACGATGAGGAGTCGGCTGCCTGGCCTCTTAAGCGGGAC
GCGGTGCCCGAGGACATGACGTCCAAGGAGCTACAGCTGTCGACGCGTCTTTCGGCTCAGGGCATCGGCGTCGGC
TATAGCGCGGGCCTCTTCGTCCAGTGCATATCCATCGCCATCTTGATATGGATGAAGAACACCACCTGGGCCCAG
CGCGTCGTCCTCTTCTTCGTCGGTACCTGGTGGTGTCTATTCACCATCCCCGCTGCCCTCTGGTTGCGGCCCAGA
CCGGGACCCCCCTTGACTGGCGACGGCAGTCTCTCGTGGATCTCGTACCTGACGTACGCGTGGAAGTCGCTGTGG
CGCACCGTCAAGCTACTCCGTCGCCTGGTGGACATTGCCTTGTTCCTGGCCGGCTGGTTTCTCCTGTCGGATGCC
ATTGCGACGACGTCGTCGACGGCCATTCTCTTCGCCAAGACGCACCTACACATGCCACCGTGGGCGCTGGGCATG
ATCAACGTCATCGTCACGCTGACGGGCGTCTTGGGAGCTTTTGGGTGGTCGTGGGTGTCGCGCATCTGGGGCATC
CAGGCCCACCAGACGATATTGGTCTGCATCGGTCTCTTCGAGCTGATACCGCTATACGGCCTGCTGGGCTACATC
CCCTTCATCGAGCAATGGGGCGTCATCGGCCTCCAGCGGCCGTGGGAGATGTACCTGCTGGCGGCCATCTACGGC
CTCGTCATGGGCGGTCTGAGCAGCTACTGCCGGTCTCTGTACGGGGAGCTGATACCGCCGGGGTCGGAAGCCGCC
TTTTACGCGCTGTACGCCATCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTGGGCGCCATCATCGAT
CGCACGGGGAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGTGCTGGTGAGCCTTCCGGCGCCTCTGATTTGGTTC
ATCGATGTCGAGAGGGGGAAGAGGGAGGCTGATAGGCTGGCTGGGACGATTGAGGGCTTTACGGTGGCGGGGACG
GGGGATGAGGGTCGGGGCATGATGGCTGATTATGATGGCGATGGGCAGCTCAGGAGACGACCGTGA
Transcript >Ophun1|3285
ATGCCATCGCCAGCCGTCTGTCCCAAGCCCCCGCTCGAAGTCCGCTCCGGTTCCTCGGACGAGGCCGACGACGAG
CGCTCCGACTCGGATGCTGAGATGATGATGGCTTCCTCTGGGGTCCCGTCTCCGCGATACTCGGGCTATGATGCG
CGTCCCACCAGTCGCAAAGAGCTGTTTGGCTGGTACATGTATGCCTTCGCCGCCGAGACGTATGTCATCTGCGGC
ATCGCCTCCTTCATACCCATCCTTCTCGAATCGCTGGCGCGCGAAAACGGCGTGCTACTCTCCGACCCGACCAAA
CCATGCGGTTCCAGCGATAGCAAGACGGATAATGACGACGGCCAGTGCGTCGTCTACGTTCTCGGCCTGCAGATC
AACACGGCCAGCTTCGCCATGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTCGTCAGCATCAGC
TGCGCCGCCGACCACGGCAACTACCGCAAGAAGCTTCTTCTGGCTTTCGCCTGGATAGGCGCCTTGGCTGTCATG
TCGTACATCTTTATCGGAAAGGAGACGTACATCCTCGGTGCCGTCCTGACCATTATATCCAACACGTCTTTCGGC
GCGTCGTTTGTCCTGCTCAATTCTTTTTTGCCGCTGCTGGTGAGGAATCATCCCGATGTTATCGGCGCACGGGGC
ACGCATACGCCTGATCTGGCGGCCACGGTGCTTGAATCGCGTCCGCTGGAGGATTCGGTCGGCGAGTTGGAGACG
CCGGCCATGGCGAGCTCTACCTCGGCGCTGTTGCCCGACGATGAGGAGTCGGCTGCCTGGCCTCTTAAGCGGGAC
GCGGTGCCCGAGGACATGACGTCCAAGGAGCTACAGCTGTCGACGCGTCTTTCGGCTCAGGGCATCGGCGTCGGC
TATAGCGCGGGCCTCTTCGTCCAGTGCATATCCATCGCCATCTTGATATGGATGAAGAACACCACCTGGGCCCAG
CGCGTCGTCCTCTTCTTCGTCGGTACCTGGTGGTGTCTATTCACCATCCCCGCTGCCCTCTGGTTGCGGCCCAGA
CCGGGACCCCCCTTGACTGGCGACGGCAGTCTCTCGTGGATCTCGTACCTGACGTACGCGTGGAAGTCGCTGTGG
CGCACCGTCAAGCTACTCCGTCGCCTGGTGGACATTGCCTTGTTCCTGGCCGGCTGGTTTCTCCTGTCGGATGCC
ATTGCGACGACGTCGTCGACGGCCATTCTCTTCGCCAAGACGCACCTACACATGCCACCGTGGGCGCTGGGCATG
ATCAACGTCATCGTCACGCTGACGGGCGTCTTGGGAGCTTTTGGGTGGTCGTGGGTGTCGCGCATCTGGGGCATC
CAGGCCCACCAGACGATATTGGTCTGCATCGGTCTCTTCGAGCTGATACCGCTATACGGCCTGCTGGGCTACATC
CCCTTCATCGAGCAATGGGGCGTCATCGGCCTCCAGCGGCCGTGGGAGATGTACCTGCTGGCGGCCATCTACGGC
CTCGTCATGGGCGGTCTGAGCAGCTACTGCCGGTCTCTGTACGGGGAGCTGATACCGCCGGGGTCGGAAGCCGCC
TTTTACGCGCTGTACGCCATCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTGGGCGCCATCATCGAT
CGCACGGGGAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGTGCTGGTGAGCCTTCCGGCGCCTCTGATTTGGTTC
ATCGATGTCGAGAGGGGGAAGAGGGAGGCTGATAGGCTGGCTGGGACGATTGAGGGCTTTACGGTGGCGGGGACG
GGGGATGAGGGTCGGGGCATGATGGCTGATTATGATGGCGATGGGCAGCTCAGGAGACGACCGTGA
Gene >Ophun1|3285
ATGCCATCGCCAGCCGTCTGTCCCAAGCCCCCGCTCGAAGTCCGCTCCGGTTCCTCGGACGAGGCCGACGACGAG
CGCTCCGACTCGGATGCTGAGATGATGATGGCTTCCTCTGGGGTCCCGTCTCCGCGATACTCGGGCTATGATGCG
CGTCCCACCAGTCGCAAAGAGCTGTTTGGCTGGTACATGTATGCCTTCGCCGCCGAGACGTATGTCATCTGCGGC
ATCGGTGAGCTTCTCGCTGCTGCGTCCGCTCTGTCTTCTTCTGATGCCGTCTCTCGCCAGCCTCCTTCATACCCA
TCCTTCTCGAATCGCTGGCGCGCGAAAACGGCGTGCTACTCTCCGACCCGACCAAACCATGCGGTTCCAGCGATA
GCAAGACGGATAATGACGACGGCCAGTGCGTCGTCTACGTTCTCGGCCTGCAGATCAACACGGCCAGCTTCGCCA
TGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTCGTCAGCATCAGCTGCGCCGCCGACCACGGCA
ACTACCGCAAGAAGCTTCTTCTGGCTTTCGCCTGGATAGGCGCCTTGGCTGTCATGTCGTACATCTTTATCGGAA
AGGAGACGTACATCCTCGGTGCCGTCCTGACCATTATATCCAACACGTCTTTCGGCGCGTCGTTTGTCCTGCTCA
ATTCTTTTTTGCCGCTGCTGGTGAGGAATCATCCCGATGTTATCGGCGCACGGGGCACGCATACGCCTGATCTGG
CGGCCACGGTGCTTGAATCGCGTCCGCTGGAGGATTCGGTCGGCGAGTTGGAGACGCCGGCCATGGCGAGCTCTA
CCTCGGCGCTGTTGCCCGACGATGAGGAGTCGGCTGCCTGGCCTCTTAAGCGGGACGCGGTGCCCGAGGACATGA
CGTCCAAGGAGCTACAGCTGTCGACGCGTCTTTCGGCTCAGGGCATCGGCGTCGGCTATAGCGCGGGCCTCTTCG
TCCAGTGCATATCCATCGCCATCTTGATATGGATGAAGAACACCACCTGGGCCCAGCGCGTCGTCCTCTTCTTCG
TCGGTACCTGGTGGTGTCTATTCACCATCCCCGCTGCCCTCTGGTTGCGGCCCAGACCGGGACCCCCCTTGACTG
GCGACGGCAGTCTCTCGTGGATCTCGTACCTGACGTACGCGTGGAAGTCGCTGTGGCGCACCGTCAAGCTACTCC
GTCGCCTGGTGGACATTGCCTTGTTCCTGGCCGGCTGGTTTCTCCTGTCGGATGCCATTGCGACGACGTCGTCGA
CGGCCATTCTCTTCGCCAAGACGCACCTACACATGCCACCGTGGGCGCTGGGCATGATCAACGTCATCGTCACGC
TGACGGGCGTCTTGGGAGCTTTTGGGTGGTCGTGGGTGTCGCGCATCTGGGGCATCCAGGCCCACCAGACGATAT
TGGTCTGCATCGGTCTCTTCGAGCTGATACCGCTATACGGCCTGCTGGGCTACATCCCCTTCATCGAGCAATGGG
GCGTCATCGGCCTCCAGCGGCCGTGGGAGATGTACCTGCTGGCGGCCATCTACGGCCTCGTCATGGGCGGTCTGA
GCAGCTACTGCCGGTCTCTGTACGGGGAGCTGATACCGCCGGGGTCGGAAGCCGCCTTTTACGCGCTGTACGCCA
TCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTGGGCGCCATCATCGATCGCACGGGGAGCATCCGGC
CGGCGTTTTGGTTCCTGGCGGTGCTGGTGAGCCTTCCGGCGCCTCTGATTTGGTTCATCGATGTCGAGAGGGGGA
AGAGGGAGGCTGATAGGCTGGCTGGGACGATTGAGGGCTTTACGGTGGCGGGGACGGGGGATGAGGGTCGGGGCA
TGATGGCTGATTATGATGGCGATGGGCAGCTCAGGAGACGACCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail