Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3283
Gene name
LocationContig_292:7110..8633
Strand-
Gene length (bp)1523
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family 4.5E-36 80 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76469|RHMA_ECOLI 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12) GN=rhmA PE=1 SV=1 65 329 2.0E-42
sp|B1IXU2|RHMA_ECOLC 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|A8A2B1|RHMA_ECOHS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O9:H4 (strain HS) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|B1X8V8|RHMA_ECODH 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / DH10B) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|C4ZU87|RHMA_ECOBW 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhmA PE=3 SV=1 65 329 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76469|RHMA_ECOLI 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12) GN=rhmA PE=1 SV=1 65 329 2.0E-42
sp|B1IXU2|RHMA_ECOLC 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|A8A2B1|RHMA_ECOHS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O9:H4 (strain HS) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|B1X8V8|RHMA_ECODH 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / DH10B) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|C4ZU87|RHMA_ECOBW 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhmA PE=3 SV=1 65 329 2.0E-42
sp|A6THU5|HPCH_KLEP7 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpcH PE=3 SV=1 65 306 5.0E-42
sp|B7NN63|RHMA_ECO7I 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhmA PE=3 SV=1 65 329 5.0E-42
sp|B1LLJ9|RHMA_ECOSM 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|Q1R9H0|RHMA_ECOUT 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain UTI89 / UPEC) GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|Q8FFN0|RHMA_ECOL6 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|A1AD97|RHMA_ECOK1 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O1:K1 / APEC GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|B7MXS6|RHMA_ECO81 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O81 (strain ED1a) GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|B7MG11|RHMA_ECO45 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhmA PE=3 SV=1 65 329 1.0E-41
sp|Q8XE09|RHMA_ECO57 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O157:H7 GN=rhmA PE=3 SV=2 65 329 1.0E-41
sp|B7N5L0|RHMA_ECOLU 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhmA PE=3 SV=1 65 329 2.0E-41
sp|B5Y2D2|HPCH_KLEP3 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Klebsiella pneumoniae (strain 342) GN=hpcH PE=3 SV=1 65 306 2.0E-41
sp|B5RCB4|RHMA_SALG2 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhmA PE=3 SV=1 65 302 5.0E-41
sp|A8A876|HPCH_ECOHS 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Escherichia coli O9:H4 (strain HS) GN=hpcH PE=3 SV=1 66 304 5.0E-41
sp|B6I2N1|HPCH_ECOSE 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Escherichia coli (strain SE11) GN=hpcH PE=3 SV=1 66 304 5.0E-41
sp|Q47098|HPCH_ECOLX 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Escherichia coli GN=hpcH PE=1 SV=1 66 304 5.0E-41
sp|B1IS70|HPCH_ECOLC 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hpcH PE=1 SV=1 66 304 5.0E-41
sp|B2TZN1|HPCH_SHIB3 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hpcH PE=3 SV=1 66 304 7.0E-41
sp|Q3YU43|HPCH_SHISS 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Shigella sonnei (strain Ss046) GN=hpcH PE=3 SV=1 66 304 8.0E-41
sp|B5FR34|HPCH_SALDC 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella dublin (strain CT_02021853) GN=hpcH PE=3 SV=1 66 306 1.0E-40
sp|Q3YZW1|RHMA_SHISS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Shigella sonnei (strain Ss046) GN=rhmA PE=3 SV=1 65 329 1.0E-40
sp|A6TBU6|RHMA_KLEP7 2-keto-3-deoxy-L-rhamnonate aldolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhmA PE=3 SV=1 65 329 1.0E-40
sp|B4TSL7|HPCH_SALSV 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella schwarzengrund (strain CVM19633) GN=hpcH PE=3 SV=1 66 306 2.0E-40
sp|Q31Z78|RHMA_SHIBS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Shigella boydii serotype 4 (strain Sb227) GN=rhmA PE=3 SV=1 65 329 2.0E-40
sp|Q0TFJ7|RHMA_ECOL5 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhmA PE=3 SV=1 65 329 2.0E-40
sp|B4T2T9|HPCH_SALNS 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella newport (strain SL254) GN=hpcH PE=3 SV=1 66 319 2.0E-40
sp|Q31SY8|HPCH_SHIBS 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Shigella boydii serotype 4 (strain Sb227) GN=hpcH PE=3 SV=1 66 304 3.0E-40
sp|Q8Z7P9|HPCH_SALTI 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella typhi GN=hpcH PE=3 SV=1 66 306 3.0E-40
sp|A9N6T0|HPCH_SALPB 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hpcH PE=3 SV=1 66 306 3.0E-40
sp|B5R6F7|HPCH_SALG2 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hpcH PE=3 SV=1 66 306 3.0E-40
sp|B5R043|HPCH_SALEP 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella enteritidis PT4 (strain P125109) GN=hpcH PE=3 SV=1 66 306 3.0E-40
sp|B5F1Y9|HPCH_SALA4 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella agona (strain SL483) GN=hpcH PE=3 SV=1 66 306 3.0E-40
sp|Q83P19|HPCH_SHIFL 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Shigella flexneri GN=hpcH PE=3 SV=1 66 304 3.0E-40
sp|Q9RPV0|HPCH_SALDU 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella dublin GN=hpcH PE=3 SV=1 66 306 6.0E-40
sp|B5FNS9|RHMA_SALDC 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella dublin (strain CT_02021853) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|Q8ZNG0|RHMA_SALTY 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|B4TPH2|RHMA_SALSV 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella schwarzengrund (strain CVM19633) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|C0Q079|RHMA_SALPC 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella paratyphi C (strain RKS4594) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|Q57M64|RHMA_SALCH 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella choleraesuis (strain SC-B67) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|B5EZG8|RHMA_SALA4 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella agona (strain SL483) GN=rhmA PE=3 SV=1 65 302 6.0E-40
sp|A9MH59|HPCH_SALAR 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hpcH PE=3 SV=1 66 306 6.0E-40
sp|B5BCQ6|RHMA_SALPK 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella paratyphi A (strain AKU_12601) GN=rhmA PE=3 SV=1 65 302 7.0E-40
sp|Q5PI50|RHMA_SALPA 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rhmA PE=3 SV=1 65 302 7.0E-40
sp|C0Q8A0|HPCH_SALPC 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella paratyphi C (strain RKS4594) GN=hpcH PE=3 SV=1 66 319 1.0E-39
sp|Q57QP9|HPCH_SALCH 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella choleraesuis (strain SC-B67) GN=hpcH PE=3 SV=1 66 319 1.0E-39
sp|B4TEM9|HPCH_SALHS 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella heidelberg (strain SL476) GN=hpcH PE=3 SV=1 66 306 1.0E-39
sp|A9N5C4|RHMA_SALPB 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhmA PE=3 SV=1 65 302 1.0E-39
sp|B4SYW1|RHMA_SALNS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella newport (strain SL254) GN=rhmA PE=3 SV=1 65 302 1.0E-39
sp|B4TBF6|RHMA_SALHS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella heidelberg (strain SL476) GN=rhmA PE=3 SV=1 65 302 1.0E-39
sp|B5R262|RHMA_SALEP 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella enteritidis PT4 (strain P125109) GN=rhmA PE=3 SV=1 65 302 1.0E-39
sp|B5BBH8|HPCH_SALPK 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella paratyphi A (strain AKU_12601) GN=hpcH PE=3 SV=1 66 306 4.0E-39
sp|Q5PG96|HPCH_SALPA 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hpcH PE=3 SV=1 66 306 4.0E-39
sp|Q8ZQ47|HPCH_SALTY 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hpcH PE=3 SV=1 66 319 9.0E-39
sp|Q8Z549|RHMA_SALTI 2-keto-3-deoxy-L-rhamnonate aldolase OS=Salmonella typhi GN=rhmA PE=3 SV=1 65 302 2.0E-38
sp|Q32DU2|RHMA_SHIDS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhmA PE=3 SV=1 65 329 5.0E-38
sp|A8AQ14|GARL_CITK8 5-keto-4-deoxy-D-glucarate aldolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=garL PE=3 SV=1 66 312 5.0E-37
sp|A6TEE9|GARL_KLEP7 5-keto-4-deoxy-D-glucarate aldolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=garL PE=3 SV=1 66 302 8.0E-37
sp|Q5PCB8|GARL_SALPA 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=garL PE=3 SV=1 66 312 2.0E-36
sp|C0PZ22|GARL_SALPC 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella paratyphi C (strain RKS4594) GN=garL PE=3 SV=1 66 312 2.0E-36
sp|O86013|BPHF_NOVAR 4-hydroxy-2-oxovalerate aldolase OS=Novosphingobium aromaticivorans GN=bphF PE=3 SV=1 66 302 3.0E-36
sp|Q7CPQ8|GARL_SALTY 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|Q8XGF9|GARL_SALTI 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella typhi GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B4TVY2|GARL_SALSV 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella schwarzengrund (strain CVM19633) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|A9N6Z0|GARL_SALPB 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B4T6B6|GARL_SALNS 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella newport (strain SL254) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B4TIX5|GARL_SALHS 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella heidelberg (strain SL476) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B5QZS6|GARL_SALEP 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella enteritidis PT4 (strain P125109) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B5FHY2|GARL_SALDC 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella dublin (strain CT_02021853) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|Q57JL0|GARL_SALCH 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella choleraesuis (strain SC-B67) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|B5F6Q5|GARL_SALA4 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella agona (strain SL483) GN=garL PE=3 SV=1 66 312 4.0E-36
sp|A9MPQ4|GARL_SALAR 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=garL PE=3 SV=1 66 302 1.0E-35
sp|B5REK4|GARL_SALG2 5-keto-4-deoxy-D-glucarate aldolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=garL PE=3 SV=1 66 312 2.0E-35
sp|B7LMV6|GARL_ESCF3 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=garL PE=3 SV=1 66 302 6.0E-35
sp|B2U092|GARL_SHIB3 5-keto-4-deoxy-D-glucarate aldolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=garL PE=3 SV=1 66 302 8.0E-35
sp|A4WEU6|GARL_ENT38 5-keto-4-deoxy-D-glucarate aldolase OS=Enterobacter sp. (strain 638) GN=garL PE=3 SV=1 66 312 1.0E-34
sp|Q3YXA5|GARL_SHISS 5-keto-4-deoxy-D-glucarate aldolase OS=Shigella sonnei (strain Ss046) GN=garL PE=3 SV=1 66 302 2.0E-34
sp|Q31WQ5|GARL_SHIBS 5-keto-4-deoxy-D-glucarate aldolase OS=Shigella boydii serotype 4 (strain Sb227) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|Q1R6L1|GARL_ECOUT 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain UTI89 / UPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B1LFM7|GARL_ECOSM 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B6I1J9|GARL_ECOSE 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain SE11) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7NDB2|GARL_ECOLU 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|Q0TCY1|GARL_ECOL5 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|A1AG35|GARL_ECOK1 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O1:K1 / APEC GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7M032|GARL_ECO8A 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O8 (strain IAI1) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7NJZ1|GARL_ECO7I 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|Q8XAE3|GARL_ECO57 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O157:H7 GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7LH62|GARL_ECO55 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain 55989 / EAEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7MB51|GARL_ECO45 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|B7UJ26|GARL_ECO27 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|A7ZS18|GARL_ECO24 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=garL PE=3 SV=1 66 312 2.0E-34
sp|Q8FDB8|GARL_ECOL6 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=garL PE=3 SV=1 66 302 2.0E-34
sp|B5YS14|GARL_ECO5E 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=garL PE=3 SV=1 66 302 8.0E-34
sp|P23522|GARL_ECOLI 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain K12) GN=garL PE=1 SV=2 66 302 1.0E-33
sp|A8A4T9|GARL_ECOHS 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli O9:H4 (strain HS) GN=garL PE=3 SV=1 66 302 1.0E-33
sp|B1XGT9|GARL_ECODH 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain K12 / DH10B) GN=garL PE=3 SV=1 66 302 1.0E-33
sp|C4ZR38|GARL_ECOBW 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=garL PE=3 SV=1 66 302 1.0E-33
sp|B1IRJ2|GARL_ECOLC 5-keto-4-deoxy-D-glucarate aldolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=garL PE=3 SV=1 66 302 1.0E-33
sp|Q32BJ0|GARL_SHIDS 5-keto-4-deoxy-D-glucarate aldolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=garL PE=3 SV=1 66 312 2.0E-33
sp|O05151|BPHF_RHOJR 4-hydroxy-2-oxovalerate aldolase OS=Rhodococcus jostii (strain RHA1) GN=bphF PE=2 SV=1 66 302 2.0E-32
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3283
MRLITFEVLYAITCQQPLLKAGRSENTTIRQIRAMAFPRSLFPALHSTTILSTRHFRTIHSMRESNRLGTALREG
RQSLGMWQMVPGANISRLLARSGVDWVLVDCEHGNMDDGAMHDAVPAIAALGVSPVVRIPDMQSWMVKRALDAGA
HGILVPLLRSAEQAREVVQAAKFPPTGRRGFGSPFSPERFSPMPSFSDYLQQANDALLTMVQIETREALEAVEEI
AAVDGIDLLFIGPFDLGNNIGHPIIQGVVAPELKEAMARILAACHKCGKKCGIYSTDGEQARQFREQGFDMISVA
TDYTALEFVLQQQLCAARGEERPSKKGSY*
Coding >Ophun1|3283
ATGCGCCTAATCACATTCGAGGTCTTGTACGCCATCACGTGCCAGCAACCCCTCCTCAAGGCGGGCCGCTCGGAG
AACACCACGATCCGCCAGATACGAGCAATGGCATTCCCCAGAAGCCTCTTCCCAGCCCTGCACAGCACAACCATC
CTGTCAACACGCCACTTCCGCACCATCCACAGCATGCGGGAAAGCAACCGGCTCGGGACCGCGCTGCGGGAAGGC
AGACAGTCGCTCGGCATGTGGCAGATGGTGCCGGGAGCCAATATCTCGAGGCTGTTGGCGCGATCGGGCGTGGAT
TGGGTGCTTGTCGACTGTGAGCATGGGAACATGGATGATGGTGCTATGCACGACGCTGTGCCGGCTATTGCTGCG
CTGGGGGTTTCGCCGGTTGTAAGGATTCCGGATATGCAGTCGTGGATGGTTAAGCGGGCGCTGGATGCCGGTGCT
CATGGAATCCTCGTCCCCCTGTTGCGCAGCGCCGAGCAGGCCAGGGAGGTGGTGCAGGCAGCCAAGTTCCCGCCC
ACGGGCAGACGGGGCTTCGGCTCGCCCTTCAGTCCCGAGCGATTCTCCCCCATGCCTAGCTTCAGCGACTATCTG
CAGCAGGCCAACGATGCTCTCCTGACCATGGTGCAGATTGAGACTCGCGAGGCGCTCGAGGCAGTGGAAGAGATT
GCTGCTGTCGATGGCATAGATCTTCTCTTCATTGGACCTTTTGATCTCGGGAATAACATCGGACACCCCATCATC
CAAGGCGTCGTCGCACCGGAGCTGAAGGAGGCCATGGCCAGGATCCTCGCCGCGTGTCACAAGTGCGGTAAGAAA
TGCGGCATCTACTCCACCGACGGCGAGCAGGCGAGACAGTTCCGCGAGCAGGGCTTCGACATGATAAGCGTGGCG
ACCGACTACACGGCCTTGGAGTTTGTACTGCAACAGCAGCTCTGCGCCGCAAGGGGCGAGGAACGTCCTTCCAAG
AAGGGTTCGTATTGA
Transcript >Ophun1|3283
ATGCGCCTAATCACATTCGAGGTCTTGTACGCCATCACGTGCCAGCAACCCCTCCTCAAGGCGGGCCGCTCGGAG
AACACCACGATCCGCCAGATACGAGCAATGGCATTCCCCAGAAGCCTCTTCCCAGCCCTGCACAGCACAACCATC
CTGTCAACACGCCACTTCCGCACCATCCACAGCATGCGGGAAAGCAACCGGCTCGGGACCGCGCTGCGGGAAGGC
AGACAGTCGCTCGGCATGTGGCAGATGGTGCCGGGAGCCAATATCTCGAGGCTGTTGGCGCGATCGGGCGTGGAT
TGGGTGCTTGTCGACTGTGAGCATGGGAACATGGATGATGGTGCTATGCACGACGCTGTGCCGGCTATTGCTGCG
CTGGGGGTTTCGCCGGTTGTAAGGATTCCGGATATGCAGTCGTGGATGGTTAAGCGGGCGCTGGATGCCGGTGCT
CATGGAATCCTCGTCCCCCTGTTGCGCAGCGCCGAGCAGGCCAGGGAGGTGGTGCAGGCAGCCAAGTTCCCGCCC
ACGGGCAGACGGGGCTTCGGCTCGCCCTTCAGTCCCGAGCGATTCTCCCCCATGCCTAGCTTCAGCGACTATCTG
CAGCAGGCCAACGATGCTCTCCTGACCATGGTGCAGATTGAGACTCGCGAGGCGCTCGAGGCAGTGGAAGAGATT
GCTGCTGTCGATGGCATAGATCTTCTCTTCATTGGACCTTTTGATCTCGGGAATAACATCGGACACCCCATCATC
CAAGGCGTCGTCGCACCGGAGCTGAAGGAGGCCATGGCCAGGATCCTCGCCGCGTGTCACAAGTGCGGTAAGAAA
TGCGGCATCTACTCCACCGACGGCGAGCAGGCGAGACAGTTCCGCGAGCAGGGCTTCGACATGATAAGCGTGGCG
ACCGACTACACGGCCTTGGAGTTTGTACTGCAACAGCAGCTCTGCGCCGCAAGGGGCGAGGAACGTCCTTCCAAG
AAGGGTTCGTATTGA
Gene >Ophun1|3283
ATGCGCCTAATCACATTCGAGGTCTTGTACGTATGCAACAAGATGAATATGTTAAGGAGCGAGGCAGTAGATACA
GTGACCGGTCTGCGCCGGTGACAAGACCGCAAGGGACGTGGACCACTGCTACTCAATGATAAAGGATAAGTGAGG
AGTCTCGATCAAGACAGCCTCCGTGGACGCCATAAGAGAGATGAGCGCGTCCAAGACGACCTTCGAGAGCGAATA
CTGATCATCCTGGGTAATTTTCCACGGACGGCTCGTCAACTCAATAATGAGCGAATATCCGTCTTTGTGCATAGA
CTGTCCAAAGAACCGCAGCTTATTGCTCTGCCGCGCGGAACTCAAGAACCAAAGGCCATCACGTGCCAGCAACCC
CTCCTCAAGGCGGGCCGCTCGGAGAACACCACGATCCGCCAGATACGAGCAATGGCATTCCCCAGAAGCCTCTTC
CCAGCCCTGCACAGCACAACCATCCTGTCAACACGCCACTTCCGCACCATCCACAGCATGCGGGAAAGCAACCGG
CTCGGGACCGCGCTGCGGGAAGGCAGACAGTCGCTCGGCATGTGGCAGATGGTGCCGGGAGCCAATATCTCGAGG
CTGTTGGCGCGATCGGGCGTGGATTGGGTGCTTGTCGACTGTGAGCATGGGAACATGGATGGTATGTGGACCGGG
GGGTAGGTGTTTGAGATGGAGTTGACGTTGGAGTAGATGGTGCTATGCACGACGCTGTGCCGGCTATTGCTGCGC
TGGGGGTTTCGCCGGTTGTAAGGATTCCGGATATGCAGTCGTGGATGGTTAAGCGTGAGTGAGTACTGAGCTTGG
TCGTGTTTGTTGCTGATGGCTTTTGATAGGGGCGCTGGATGCCGGTGCTCATGGAGTGAGTTTGACTCCGGGTTT
CCTCTCGGAGAGACGCGACGACGCTGATGATGCAATACAAGATCCTCGTCCCCCTGTTGCGCAGCGCCGAGCAGG
CCAGGGAGGTGGTGCAGGCAGCCAAGTTCCCGCCCACGGGCAGACGGGGCTTCGGCTCGCCCTTCAGTCCCGAGC
GATTCTCCCCCATGCCTAGCTTCAGCGACTATCTGCAGCAGGCCAACGATGCTCTCCTGACCATGGTGCAGATTG
AGACTCGCGAGGCGCTCGAGGCAGTGGAAGAGATTGCTGCTGTCGATGGCATAGATCTTCTCTTCATTGGACCTT
TTGATCTCGGTGAGCTGAACGGGTGACTCCAACTTTCATCTCTGACTCATGGGACAGGGAATAACATCGGACACC
CCATCATCCAAGGCGTCGTCGCACCGGAGCTGAAGGAGGCCATGGCCAGGATCCTCGCCGCGTGTCACAAGTGCG
GTAAGAAATGCGGCATCTACTCCACCGACGGCGAGCAGGCGAGACAGTTCCGCGAGCAGGGCTTCGACATGATAA
GCGTGGCGACCGACTACACGGCCTTGGAGTTTGTACTGCAACAGCAGCTCTGCGCCGCAAGGGGCGAGGAACGTC
CTTCCAAGAAGGGTTCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail