Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3277
Gene name
LocationContig_291:5270..16837
Strand+
Gene length (bp)11567
Transcript length (bp)11460
Coding sequence length (bp)11460
Protein length (aa) 3820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20206 Tra1_ring Tra1 HEAT repeat ring region 0.0E+00 894 2653
PF20175 Tra1_central Tra1 HEAT repeat central region 4.3E-221 288 882
PF02259 FAT FAT domain 5.8E-73 2799 3150
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 8.5E-31 3494 3750
PF02260 FATC FATC domain 5.7E-06 3788 3819

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 12 3819 0.0E+00
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 10 3819 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 1834 3819 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 50 1608 0.0E+00
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 79 3819 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 12 3819 0.0E+00
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 10 3819 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 1834 3819 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 50 1608 0.0E+00
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 79 3819 0.0E+00
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 1308 3819 0.0E+00
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 6 3819 0.0E+00
sp|G5EEV2|TRR1_CAEEL Transcription-associated protein 1 OS=Caenorhabditis elegans GN=trr-1 PE=2 SV=1 22 1228 2.0E-78
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 2639 3216 2.0E-74
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 211 906 2.0E-74
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 1295 2024 1.0E-64
sp|G5EEV2|TRR1_CAEEL Transcription-associated protein 1 OS=Caenorhabditis elegans GN=trr-1 PE=2 SV=1 1855 3216 6.0E-47
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 584 1228 1.0E-44
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 1835 3204 5.0E-41
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 22 468 7.0E-29
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 3440 3774 7.0E-18
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 3440 3749 4.0E-16
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 3440 3818 6.0E-16
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 3440 3749 4.0E-15
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 3440 3749 4.0E-15
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 3440 3749 5.0E-15
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 3413 3819 1.0E-14
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 3369 3749 5.0E-14
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 3440 3749 9.0E-14
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 3440 3749 2.0E-13
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 3478 3749 4.0E-13
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 3440 3749 9.0E-13
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 24 159 2.0E-12
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 3478 3747 2.0E-12
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 3440 3749 2.0E-12
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 3423 3819 4.0E-12
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 3462 3819 2.0E-11
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 3440 3749 4.0E-11
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 3423 3749 5.0E-11
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 3440 3749 8.0E-11
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 3423 3749 2.0E-10
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 3423 3771 2.0E-10
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 3423 3755 7.0E-10
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 3423 3749 3.0E-09
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 3503 3819 4.0E-09
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 3503 3819 5.0E-09
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 3503 3819 1.0E-08
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 3455 3818 1.0E-07
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 3486 3818 4.0E-07
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 3458 3818 4.0E-07
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 3486 3818 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4020
Ophiocordyceps australis map64 (Brazil) OphauB2|1373
Ophiocordyceps camponoti-floridani Ophcf2|05848
Ophiocordyceps camponoti-rufipedis Ophun1|3277 (this protein)
Ophiocordyceps kimflemingae Ophio5|5061
Ophiocordyceps subramaniannii Hirsu2|8038

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3277
MAGTTIDDVVRRLSTADLDARLKLEAATTLRDSLDHYTSGSIYPPFLKRLVPIFVNILRGPPIFQSNSAEQKLRH
CVLEVLHRLPTQPAPTEPFEPYAEEVCDLLMHLVRTDNEDNATLCIKITSDIMRHQHKVLQGKVQTFLSLIQELF
EQMDKVVREQLDNAPSVASSQPGAPSTPGSSQMSFQSPRPGSPVASVSDLGADPQQQNRSLLRGMQSFKVLSECP
IIVVSIFQIYRSTVAQNVKAFVPLIKGVLLLEASAQRQAHADAAAKGQIFTGVSPAIKNRAAFGEFITAQVKTMS
FLAYLLRQYSQQLTDFLPTLPDVVVRLLKDCPREKSGTRKELLIAIRHIINYNFRKIFLPKIDELLDERTLTGDG
LTVYETMRPLAFSMLADLIHHVRDSLSPEQIRKTVEVYTKNLQDNFPGTSFQTMSAKLLLNMAECIAKLPNKVNA
RHYLIMILNAIADKFAAMNRQYPNAVKLSKQYHQQAAAGTPESYLADKDCPPDWDETDIFSAVPIKISNPRDRGA
DPLVDNKFLFRNLLNGLKNTFYQLRTCNIGSPIDPENAPSHWQDVSYGFTAEEVNVIIKLFREGTYVFRYYEIEK
PASESQYMSPVEYMANFYMVSSSKEEKDLIETFATVFHCIDPATFHEVFQQEIPRLYDMIFEHTALLHIPQFFLA
SEATSPSFCGMLLQFLMERIDEVGSADVKKSSILLRLFKLAFMAVTLFAGQNEQVLLPHVVNIVTKSIELSTKAE
EPMNYFLLLRSLFRSIGGGKFEQLYKQILPLLEMLLDVLNNLLMAARKQSERDLYVELCLTVPARLSHLLPHLSF
LMRPLVVALRAGTDLVGQGLRTLELCVDNLTADYLDPIMAPVIDELMNSLFNHLKPHPYSHFHAHTTMRILGKLG
GRNRKFMSGAVPLTCKPYADDSSSFDVRLIGSKKDRAFPADLGIDSAIQKLMEAPKMGKSSQNRQYDEYYKKQAV
HFIIAQLKLRIGYDQLPEDLPRIVRLQAQDLMTRKMDFNFAPFEASNRDKSIAKKDEQDKITKQLIKAVMFSQTI
PAFKDEADAFLLDVCRHFAIIEVGRSLVDIKRSVSPFDPRAGEGPLHIETRVLSDAIVESLASDHPDLREAAKRA
IRELYQCSAVIFGSEVNVGRLPLFSHLSSTFCHSCYEEEWFTKTGGSLGINFLLTELDFGDAWVASKQTEFIRAL
MYVIKDMPQDLPERTRCLAQTSLEVLLRRITKNIKKEDALPVFQPPGQPPVKQPRLAQICLQFNNELSHMNKFVR
ETARLSLESVAKAAGCEVWELVEPYRERFLQPIYSKPLRALPFSIQIGYINAMTYHMSLKSEWVKFDDNLNRLLM
ESLALADANDESLANKPAEYRTHEHIVTLRISCIKLLSTAMTFEEFANNPTKGKILAVFFKCLYSESKPTIDAAN
DALRSVLAVDRRLPKDLLQGGLRPVLQSLSDPKRLTTHGLDNLSRLLKLLTSYFKVEIGSRLLDQIDSILDPGQL
QQMSFTFFEQNPQMKVIVAIFNIFHLLPSQAEAFKEALIDSFLSLEEKLRRTIHSPFRQPMYLYLNRYPKEVWGF
LVGRLDDLKYGRLLAQVLRHPDSGPLREVATEKVDALMQRCNEAASQGVDKKFTAIVNTVHVLDSISQWTSNNGW
MDRRDCIAWLKTVGKDLESHLGGYALPANLRLPAYQAAEQLMGILVKSLHRNPRDLDALFNLIESVTTEELRPTH
ALFSFIYARIICSESIDFWKTTFLRCLDMYSSKTTLNKTKHFLLHYIVSPIVAMDVMRHWNQPESGRPQRLMDRS
VIDAVSSRIWKVHPEMAADDQAQPGIDHTRFEVLQLSAMLVKYHHVLLQEARKDIIKFGWTFIRLDDVINKHAAY
VVIGYFIAHYETPPKIVNQVYISLLKTNQNEGRALVTQALELIAPVLPKRCGSGPNERNAAWAVAPRRILADEGQ
NVQQMTSIFHFLVRHPDLFFDARDKYAILLITSLRKVAAPPNPSHESRKLALNMMWLIWTWEQWRVEGGRPSVRD
SSQSPTSRKRKFEADVSPTTVRQQQQPLANEYQIPPVFRQKMIKYLVEFIAQLNERYHLPSAKPRELNPATIPLP
PPNTELCKKAMSLLYNLVQPRYWGDLELDLFPNVTDVILGSDKTQVILNADPADKEKYDERFLTNIINTLQVVRI
VLNFKSDEWVQKNMAAVQKVLEKCLRCENAEIQDCLHLADSNYDDERELRSIIQRVLDAVPEDTPMEDAEAETEA
EAQTSEIVSYLSQAATEAMNNGSYISGVNLLWSLGKRKPAVIDQHVASLMKALQSKHAREHVQYYNAVASQAAAA
GSRGQDGAPAANEMAAYDLEIQTKLIIKEIQTVALRMEHLGDNRRPFLSVLATLVEKSMHIELCSEILAMVEGWV
FRSEGTWPTLKEKTAVLHKMLSFEHRQDSTMLSKFLDLVIRIYEDPKITRTELTVRMEHAFLIGTRAADVEMRNR
FMALFDKSLSRTASLRFAYVLTSQNWDTLADSYWLAQASQFMLGGIDGGTGIHLDAEDFRVTPLSELAAVFPRDR
EPRAATDDKLEGLMAGHRRFVAELGDVKVRDVLEPLMQLQHVDTALAHQLWVVEFPLFWSATLREDRAELERGIV
ALLTKDYHSRQLDKRPNVMQSLVEGCVKTWPQCKLPPHVLKFEAKTFDVWYAAMVQLERAAIRPETDSATVRESN
LDALLDLYAALQEEDLFYGTWRRRCQFVETNAGLSYEQSGMWDKAQRLYETAQVKARTGVIPFSQAEYMLWEDHW
VLCAQKLQQWEILHDFAKHENFQDLLLECAWRNTDMWQDAQHREVLDNVIKGVMDAPTPRRAFFQAFMSLLKFHN
QQENALELARVCDEAIQLSIRKWHQLPERLTQAHVPLLQNFQQLVEMHDASVICQSLASTNAGNLDVKSGELKLL
LGAWRDRLPNVWDDITAWQDLVSWRQHIFSLINQTYLQLLPPQAQQNAGGANSFAYRGYHETAWIINRFAHVARK
HSLPEVCISQLSRIYTLPNIEIQEAFLKLREQAKCHYENADELSSGLDVINNTNLNYFNPQQKAEFYTLKGMFLE
KLKHKDEADNAYGTALYFDIGAAKAWAEWGHFNDRKFKEEPSDLNAARQALTSYLQAAGSYKNAKSRKLLARILW
LLSLDDAKGTIAMGFDDFKGETPVWYWITLIPQLLTGLGHKEAPRVYQILLSIAKSYPQALYFQLRTNREDMHVI
RKSQETKERARQQRASSSNMSPTKAEADAEVKAENAADGAEGGGSTTTTTDQHQQQQQQQLQQKKPPWELTEEIM
SVLKTAFPLLALSMEAMVDQIQKHFKCPPDEDAYRLIVALLNDALTYVSRTPASFARSVKLPAATETNITRFAET
ILPTHIKKSFEKDFVEVKPTMYEYIHKLRRWRTKFEEKLDRRVAHAPLEAFSSHLSEFRYQKFDEVEIPGQYLQH
KDKNQDFVQIERFLPNVDLVRSYSASYRRLKMRGHDGSVHAWAVQHPAARHCRREERILQLFRQLNQTLGRKKES
RRRSLEFTLPVMVPLAPHIRIVAEDTSYVTLQAVFEDHCRRHGQAKDDPVLYTLEKLRGVLDSDSPQAKLELTPS
ARLEVLQAVQDKWVPQTTALDYFQLVFPQFAEFWLFRRQFSYQLSALSFMTYILYMHNRYPSKMSIARASGNIWG
SELMSFMNPHKPFFTNPEPVPFRLTPNLQVLMGPLATEGIFACAVMAIARSLTEPEDELEHALTLFVRDEMIFWL
TSSHRSAISESQLRDSVQLNSDSIVKRAASLARNPSGNLPANQTVIDAVAKAVNPMNLAQCDALWMPYL*
Coding >Ophun1|3277
ATGGCGGGAACAACCATCGACGACGTCGTGAGACGCCTCAGCACCGCCGATCTAGATGCGAGGCTGAAGCTCGAG
GCTGCCACAACGTTACGCGATAGTCTAGATCATTACACCAGCGGTTCGATATACCCACCCTTCCTCAAACGACTT
GTCCCCATCTTCGTCAATATCCTACGCGGGCCGCCCATCTTTCAGAGCAACTCGGCGGAACAGAAACTCCGTCAC
TGTGTCCTCGAAGTCCTCCACCGATTGCCGACCCAGCCTGCGCCGACCGAGCCGTTCGAGCCATACGCCGAGGAA
GTCTGCGATTTGCTCATGCACCTCGTCCGCACCGACAACGAAGACAACGCGACACTATGTATCAAGATAACTTCC
GACATCATGCGCCACCAGCACAAGGTCCTCCAGGGCAAGGTCCAGACCTTTCTCTCCCTTATCCAGGAGCTCTTC
GAGCAGATGGACAAGGTCGTGCGCGAGCAGCTCGACAACGCGCCATCCGTCGCCTCCTCGCAGCCTGGAGCCCCG
TCGACGCCGGGAAGCTCGCAGATGAGCTTCCAGTCGCCCCGGCCCGGCTCGCCCGTGGCGTCCGTCTCGGACTTG
GGCGCCGATCCCCAGCAGCAGAACCGCTCTCTCTTGCGGGGCATGCAATCGTTCAAGGTCCTTTCCGAGTGCCCC
ATCATCGTCGTTTCCATCTTCCAAATCTATCGCTCGACCGTCGCCCAAAACGTCAAGGCCTTTGTCCCTCTCATC
AAGGGCGTGCTGCTGCTCGAGGCCAGCGCCCAGAGACAGGCCCATGCCGACGCTGCCGCCAAGGGGCAAATCTTC
ACCGGCGTGAGCCCGGCCATCAAGAACAGGGCTGCTTTCGGAGAGTTCATCACGGCTCAGGTCAAGACGATGAGC
TTCCTGGCCTACCTCTTGCGCCAGTACTCGCAGCAGCTGACGGATTTCTTGCCGACGCTGCCCGATGTCGTCGTC
CGGCTGCTGAAAGACTGCCCGCGTGAAAAGTCGGGGACCAGAAAGGAGTTGCTCATCGCCATTAGACACATCATC
AACTACAACTTTCGCAAGATATTCCTCCCCAAGATCGACGAATTGCTGGACGAGAGAACCCTGACCGGCGACGGC
TTGACTGTCTACGAGACTATGCGTCCCTTAGCGTTCAGCATGTTGGCCGATCTCATACACCACGTCCGAGACTCT
CTGAGCCCGGAGCAGATCCGCAAGACCGTCGAGGTCTACACCAAGAATCTGCAGGACAACTTCCCCGGCACCAGC
TTTCAGACCATGAGTGCCAAGCTCCTCCTCAACATGGCAGAGTGCATCGCCAAGCTGCCCAACAAGGTGAACGCG
AGGCATTACCTCATCATGATCCTCAACGCCATCGCCGACAAGTTTGCCGCCATGAACCGCCAGTATCCCAACGCG
GTCAAGCTCTCGAAGCAATATCATCAGCAGGCGGCAGCGGGCACGCCCGAGTCGTATCTGGCCGACAAGGATTGT
CCGCCTGATTGGGACGAGACGGACATCTTCTCCGCCGTGCCCATCAAAATCTCCAACCCTCGCGATCGGGGCGCC
GACCCTCTGGTAGACAACAAGTTCCTCTTCAGGAACCTGCTGAATGGTCTTAAGAATACCTTCTACCAGTTGCGG
ACGTGCAACATTGGCAGCCCCATCGATCCCGAGAACGCGCCGTCGCATTGGCAGGATGTCTCGTATGGCTTCACG
GCTGAGGAAGTCAACGTCATCATCAAGTTGTTCAGGGAGGGCACCTACGTCTTTCGATACTACGAGATTGAGAAG
CCCGCTTCCGAGTCTCAGTACATGTCGCCGGTGGAATACATGGCCAACTTCTACATGGTGTCGAGCAGCAAGGAA
GAAAAGGACTTGATAGAGACATTCGCCACCGTCTTTCACTGCATCGACCCTGCGACGTTCCACGAGGTGTTCCAG
CAGGAGATTCCTCGGCTGTACGACATGATCTTTGAGCACACGGCCCTCCTGCACATACCGCAGTTCTTCCTCGCC
AGCGAGGCTACGTCGCCGAGCTTCTGCGGTATGCTGCTGCAGTTTCTCATGGAGCGCATCGACGAGGTCGGATCG
GCCGACGTCAAGAAGTCGTCTATTCTGCTGCGGCTCTTCAAGCTAGCCTTCATGGCCGTCACCCTATTCGCCGGA
CAGAACGAGCAAGTTCTCCTCCCTCACGTCGTCAACATCGTGACCAAGTCCATCGAGCTCTCCACCAAGGCGGAG
GAGCCCATGAACTACTTTCTCCTTTTGCGCTCTCTGTTCAGAAGCATAGGGGGCGGGAAATTCGAGCAGCTCTAC
AAGCAGATCTTGCCTTTGCTGGAGATGCTCCTGGACGTTCTCAACAACCTTCTCATGGCTGCGCGGAAACAGTCG
GAGCGGGATCTGTACGTGGAGCTGTGCCTCACCGTTCCTGCCCGTCTCAGCCACCTGCTTCCGCATCTGAGCTTC
TTGATGAGGCCCCTCGTCGTGGCTCTGCGAGCGGGAACAGATCTCGTTGGTCAGGGGTTGCGGACATTGGAGTTG
TGTGTGGACAACCTGACGGCCGATTACCTGGATCCCATCATGGCACCAGTCATCGACGAGCTCATGAATTCCCTC
TTCAACCACCTCAAGCCGCACCCCTACAGCCACTTCCACGCCCACACCACCATGAGGATCCTGGGCAAACTCGGG
GGGAGGAATCGCAAGTTTATGTCGGGCGCTGTGCCTCTCACCTGCAAACCCTACGCCGACGACTCGAGCAGCTTC
GACGTCCGCCTCATCGGATCCAAGAAGGATCGGGCCTTTCCGGCAGATCTCGGCATCGACTCCGCCATCCAGAAA
CTCATGGAGGCCCCCAAGATGGGGAAGAGCAGCCAGAATCGCCAGTACGACGAGTACTACAAGAAGCAGGCCGTT
CACTTCATCATCGCTCAGCTCAAGCTGCGGATTGGCTACGACCAGTTGCCGGAAGACTTGCCGAGAATCGTTCGC
CTTCAGGCTCAGGATCTCATGACCCGCAAGATGGACTTTAATTTTGCGCCGTTTGAGGCCTCGAACCGCGACAAG
TCCATTGCGAAAAAGGACGAGCAGGATAAAATCACCAAGCAGCTGATTAAGGCCGTCATGTTCTCGCAGACGATA
CCGGCCTTCAAGGACGAAGCCGACGCGTTTCTCCTCGATGTCTGCAGGCACTTTGCCATCATCGAGGTGGGGCGC
TCTCTCGTCGACATCAAGCGCAGCGTCAGTCCCTTTGATCCTAGAGCCGGCGAGGGCCCCCTGCACATCGAGACG
AGGGTCTTGTCGGACGCAATCGTCGAGTCCCTGGCGTCTGACCACCCGGACTTGCGCGAGGCGGCCAAGCGGGCC
ATCCGAGAGCTCTACCAATGCTCGGCCGTCATCTTCGGCTCCGAGGTCAACGTCGGCCGTCTGCCCCTTTTCAGC
CATCTCAGCAGCACCTTTTGCCACAGCTGCTACGAGGAGGAATGGTTCACCAAGACCGGAGGTAGCCTGGGCATC
AACTTTCTCCTCACCGAGCTGGACTTTGGCGATGCCTGGGTGGCGTCCAAGCAGACGGAGTTCATCCGCGCCCTC
ATGTACGTCATCAAGGACATGCCTCAGGATCTTCCGGAGAGGACTAGGTGTCTGGCCCAGACGAGCCTCGAGGTT
CTCCTGAGACGCATCACCAAGAACATCAAAAAGGAAGACGCCCTGCCCGTCTTCCAGCCGCCCGGTCAGCCGCCC
GTCAAGCAGCCGCGGCTCGCGCAGATCTGCCTGCAGTTCAACAACGAGCTCTCGCATATGAACAAGTTCGTCCGC
GAGACGGCCAGACTCTCGCTCGAGTCCGTGGCCAAGGCTGCCGGCTGCGAGGTGTGGGAGCTCGTCGAGCCCTAC
AGGGAGAGGTTTCTGCAACCCATCTACTCCAAGCCCCTGCGCGCGCTGCCATTTAGCATCCAGATCGGGTACATC
AACGCCATGACGTATCACATGAGCCTCAAGAGCGAATGGGTCAAGTTCGACGACAACCTGAACCGGCTGCTCATG
GAGTCTCTGGCCCTGGCGGACGCAAATGATGAATCGCTGGCCAACAAGCCCGCCGAGTACCGCACGCACGAGCAC
ATTGTGACGCTGAGGATCTCATGCATCAAATTGCTCAGTACGGCCATGACGTTTGAGGAGTTTGCCAACAACCCG
ACCAAGGGCAAAATTTTGGCCGTCTTCTTCAAGTGCCTATACTCGGAATCGAAGCCGACCATCGATGCGGCTAAC
GACGCGTTGCGGTCGGTCCTGGCCGTCGACAGGCGTCTGCCCAAGGACCTGCTGCAGGGAGGCTTGCGTCCCGTG
TTGCAGAGTCTATCGGACCCGAAGCGCTTGACGACGCATGGTCTGGACAATCTCTCGAGGCTGCTGAAGCTCTTG
ACCAGCTATTTCAAGGTCGAGATTGGTTCCCGCCTCCTCGATCAGATTGATTCCATCCTGGACCCCGGGCAGTTG
CAGCAGATGTCGTTTACCTTTTTCGAGCAGAATCCGCAGATGAAGGTCATCGTTGCTATCTTCAACATCTTTCAC
CTGTTGCCGTCTCAGGCTGAGGCGTTCAAAGAAGCCCTCATCGACAGCTTTCTTAGCTTGGAAGAGAAGCTCAGG
AGGACGATTCACAGCCCGTTCAGGCAGCCCATGTACCTCTATCTGAATAGGTACCCGAAGGAGGTCTGGGGCTTC
CTCGTCGGTCGACTGGACGACCTCAAATACGGGCGACTGCTGGCCCAAGTCTTGCGGCACCCGGACAGCGGTCCT
CTCCGAGAAGTGGCGACGGAAAAGGTGGACGCCTTGATGCAGAGGTGCAACGAGGCAGCGTCTCAGGGGGTCGAC
AAGAAGTTTACGGCCATCGTCAACACGGTGCACGTGCTCGACTCGATAAGCCAGTGGACGTCTAACAACGGCTGG
ATGGATAGGAGGGACTGCATCGCGTGGCTCAAGACGGTCGGCAAAGACTTGGAGAGTCATCTCGGTGGCTACGCG
TTGCCGGCCAACCTCCGGCTTCCGGCCTACCAGGCGGCGGAGCAGCTGATGGGCATCCTGGTCAAGTCGCTCCAC
AGGAACCCGAGGGATCTGGACGCGCTGTTCAACCTGATTGAGTCGGTGACGACGGAGGAGCTCAGGCCGACGCAT
GCGCTCTTCTCGTTCATCTACGCCAGAATCATCTGCAGCGAGTCCATCGACTTTTGGAAAACGACCTTCTTGCGG
TGCCTCGACATGTATTCGAGCAAGACGACGCTCAACAAGACGAAGCACTTTTTGTTGCACTACATCGTCAGCCCC
ATCGTCGCCATGGACGTGATGCGTCACTGGAACCAGCCGGAGTCGGGCAGGCCGCAGCGGCTCATGGACCGGAGC
GTCATCGACGCCGTCAGCTCGAGGATATGGAAAGTTCATCCGGAGATGGCGGCCGACGACCAAGCACAGCCAGGA
ATCGACCATACGAGGTTCGAGGTCCTCCAACTGTCTGCGATGCTGGTCAAGTATCACCACGTGCTACTGCAAGAG
GCGCGCAAGGACATCATCAAGTTTGGATGGACCTTTATCCGGCTCGACGACGTCATCAACAAGCACGCGGCGTAC
GTGGTCATCGGCTACTTCATCGCCCATTACGAGACGCCTCCCAAGATCGTCAACCAGGTCTACATCTCGCTGCTC
AAGACGAACCAGAACGAGGGGAGGGCGCTGGTGACGCAGGCGCTGGAGCTCATCGCCCCCGTGCTTCCCAAGCGG
TGCGGCAGCGGTCCCAACGAGCGCAACGCGGCCTGGGCGGTGGCGCCGCGGCGGATCCTGGCCGACGAGGGCCAG
AACGTGCAGCAGATGACGAGCATCTTTCACTTCCTGGTGCGGCATCCGGATCTGTTCTTCGACGCGCGGGACAAG
TACGCCATCCTGCTCATCACGTCGCTCAGAAAGGTGGCGGCGCCGCCGAATCCGTCTCACGAGAGCAGGAAGCTG
GCTCTTAACATGATGTGGCTCATCTGGACTTGGGAGCAGTGGCGCGTCGAGGGCGGGCGGCCTTCTGTTCGGGAC
TCGTCTCAGTCGCCGACTTCACGGAAGCGCAAGTTCGAGGCCGACGTGTCGCCGACGACGGTGAGGCAGCAGCAG
CAGCCCCTGGCCAACGAATATCAGATCCCGCCCGTGTTCCGGCAGAAGATGATCAAGTATCTGGTCGAGTTCATC
GCCCAGCTGAACGAGCGATATCATCTGCCATCGGCGAAGCCCCGTGAACTGAACCCGGCGACGATTCCGCTGCCG
CCGCCCAACACGGAGCTCTGCAAGAAGGCCATGAGCCTGCTGTACAATCTCGTGCAGCCTCGGTACTGGGGCGAT
CTTGAGCTCGACCTATTCCCCAATGTTACGGACGTGATCCTGGGGAGCGATAAGACGCAGGTCATCCTCAACGCC
GACCCAGCCGATAAGGAAAAGTACGACGAGAGGTTCCTGACCAACATCATCAACACGCTGCAGGTGGTGCGCATC
GTGCTCAACTTCAAGTCGGACGAGTGGGTGCAGAAGAACATGGCGGCGGTGCAAAAGGTGCTGGAGAAGTGCCTC
CGATGCGAGAATGCCGAGATCCAGGACTGCCTGCACCTGGCCGACAGCAACTACGACGACGAGCGCGAGCTCCGG
TCCATCATCCAGCGCGTGCTCGATGCCGTGCCCGAGGACACGCCCATGGAGGACGCCGAGGCAGAGACGGAAGCA
GAGGCGCAGACGTCGGAGATTGTGTCGTACCTCTCGCAGGCGGCGACCGAGGCCATGAACAACGGATCGTACATC
TCGGGCGTCAACCTCCTCTGGTCGCTGGGAAAGCGGAAGCCGGCCGTCATCGACCAGCACGTGGCGTCGCTCATG
AAGGCTCTGCAGAGCAAGCACGCCAGGGAGCACGTGCAGTATTACAACGCCGTGGCCAGCCAGGCGGCGGCGGCC
GGCAGCCGAGGCCAGGATGGGGCTCCGGCGGCGAACGAGATGGCGGCTTACGACCTGGAGATACAGACGAAGCTG
ATCATCAAGGAGATCCAGACGGTGGCGCTGCGGATGGAGCACCTGGGCGACAACCGGAGGCCGTTTCTCAGCGTG
CTGGCGACGCTGGTGGAGAAGTCGATGCACATTGAGCTCTGCAGCGAGATACTGGCCATGGTCGAGGGCTGGGTG
TTTCGATCCGAAGGGACGTGGCCGACGCTCAAGGAGAAGACGGCGGTGCTGCATAAGATGTTGTCGTTTGAGCAC
CGGCAGGACTCGACGATGCTGTCCAAGTTCCTCGACCTGGTGATACGCATCTACGAGGACCCCAAGATTACGCGG
ACGGAGCTGACGGTGCGGATGGAGCACGCGTTCCTCATCGGCACGAGGGCAGCCGACGTCGAGATGCGCAACCGG
TTCATGGCCCTGTTCGACAAGAGCCTGTCGCGGACGGCGAGCCTGCGGTTCGCGTACGTGCTGACGAGCCAGAAC
TGGGACACGCTGGCCGACTCGTACTGGCTGGCGCAGGCGTCGCAGTTTATGCTGGGCGGCATCGACGGCGGCACG
GGCATCCACCTTGACGCCGAGGACTTCCGGGTGACGCCGCTGTCGGAGCTGGCGGCGGTGTTCCCCCGGGATCGG
GAGCCCCGGGCGGCGACGGACGACAAGCTCGAGGGGCTGATGGCGGGCCACCGGCGGTTCGTGGCGGAGCTGGGC
GACGTCAAGGTGCGAGACGTGCTGGAGCCCCTGATGCAGCTACAGCACGTCGATACGGCGCTGGCTCATCAACTC
TGGGTGGTCGAGTTCCCGCTCTTCTGGTCGGCGACTCTGCGCGAGGACAGGGCCGAGCTGGAGCGAGGCATCGTG
GCCCTCCTGACCAAGGACTACCACAGCCGACAGCTGGACAAGCGACCCAACGTGATGCAGTCGCTGGTCGAGGGC
TGCGTCAAGACGTGGCCTCAGTGCAAGCTCCCACCACACGTGCTCAAGTTCGAGGCCAAGACGTTTGACGTGTGG
TACGCGGCCATGGTGCAGCTGGAACGGGCGGCCATCAGGCCCGAGACGGACTCGGCCACGGTACGGGAGAGCAAC
CTGGACGCGCTGCTGGATCTCTACGCTGCGCTGCAGGAGGAGGACCTCTTCTACGGCACTTGGAGGCGACGCTGC
CAGTTCGTCGAGACCAACGCGGGCCTGTCGTACGAGCAGAGCGGCATGTGGGATAAGGCGCAGCGGCTGTACGAG
ACGGCGCAGGTCAAGGCGAGGACGGGCGTGATTCCCTTCTCGCAGGCCGAGTACATGCTGTGGGAGGATCACTGG
GTGCTGTGCGCTCAGAAGCTGCAGCAGTGGGAGATTCTTCACGACTTCGCCAAGCACGAGAACTTCCAGGACCTG
CTGCTCGAGTGCGCGTGGCGGAACACGGACATGTGGCAGGACGCCCAGCACCGCGAGGTGCTCGATAACGTCATT
AAGGGAGTCATGGACGCGCCGACGCCGCGGAGGGCCTTCTTCCAGGCCTTTATGTCGCTGCTCAAGTTCCACAAC
CAGCAGGAGAACGCGCTGGAGTTGGCACGCGTGTGTGACGAGGCCATTCAGCTGTCGATCCGCAAGTGGCACCAG
CTTCCGGAGCGGCTCACGCAGGCGCATGTTCCGCTGCTGCAGAACTTCCAGCAGCTGGTCGAGATGCACGATGCC
AGCGTCATCTGCCAGAGCCTGGCCAGCACCAACGCGGGCAACCTCGACGTCAAGTCGGGCGAGCTCAAGCTGCTT
CTGGGCGCCTGGCGAGATCGGCTGCCCAACGTGTGGGACGACATCACGGCCTGGCAGGACTTGGTATCGTGGCGG
CAGCACATCTTCAGCCTCATCAACCAGACCTACCTCCAGCTGCTGCCGCCTCAGGCTCAGCAGAACGCGGGAGGC
GCCAACTCGTTCGCCTACCGCGGCTATCACGAGACGGCCTGGATCATCAACCGCTTCGCCCACGTGGCGCGCAAG
CACAGCCTGCCCGAGGTGTGCATCAGCCAGCTCAGCCGCATCTATACGCTGCCCAACATTGAGATTCAGGAGGCC
TTTTTGAAGCTGCGCGAGCAGGCCAAGTGTCACTACGAGAATGCCGACGAACTGTCAAGCGGGCTCGACGTCATC
AACAACACCAACCTCAACTACTTCAACCCGCAGCAAAAGGCCGAGTTCTATACGCTCAAGGGCATGTTTCTCGAG
AAGCTCAAGCACAAGGACGAGGCCGACAACGCCTACGGAACGGCCCTGTACTTTGATATAGGAGCGGCAAAGGCC
TGGGCTGAATGGGGTCACTTCAACGACCGCAAGTTCAAGGAGGAACCGTCGGATCTCAACGCGGCGCGTCAGGCT
CTGACGTCGTATCTCCAGGCGGCCGGCAGCTACAAGAACGCCAAGTCGCGCAAGCTGCTGGCCCGGATCCTGTGG
CTGCTGAGCCTCGACGACGCCAAGGGAACCATCGCCATGGGCTTCGACGACTTCAAGGGCGAGACGCCCGTTTGG
TACTGGATCACGCTCATCCCCCAGCTGCTGACGGGGCTGGGCCACAAGGAGGCGCCTCGCGTCTATCAGATCTTG
CTGAGCATCGCCAAGTCGTACCCGCAGGCGCTGTACTTTCAACTGCGAACCAACCGCGAGGACATGCACGTCATA
CGCAAGAGTCAGGAGACCAAGGAGCGGGCGAGGCAGCAGCGGGCTTCCAGCAGCAACATGTCGCCGACGAAGGCC
GAAGCCGACGCCGAGGTCAAGGCTGAGAACGCGGCCGATGGTGCAGAAGGGGGCGGTTCGACGACGACGACGACG
GATCAACACCAGCAGCAGCAGCAGCAGCAACTTCAACAGAAGAAGCCACCGTGGGAACTCACAGAGGAGATCATG
TCGGTCCTCAAGACGGCCTTCCCCCTGCTGGCCCTCTCCATGGAGGCCATGGTGGACCAGATCCAGAAGCACTTC
AAGTGTCCGCCCGACGAGGACGCCTACAGGCTCATCGTGGCCCTCCTCAACGACGCCCTCACCTACGTCAGCCGC
ACGCCGGCCTCGTTTGCCCGCAGCGTCAAGTTGCCTGCCGCCACCGAGACCAACATCACGCGCTTCGCCGAGACG
ATCCTACCGACTCACATCAAGAAGTCGTTTGAGAAGGACTTTGTCGAGGTCAAGCCCACCATGTACGAGTACATC
CACAAGCTGCGACGATGGCGTACCAAGTTCGAGGAGAAGCTGGACAGACGCGTCGCCCACGCGCCCCTCGAGGCC
TTTTCTTCCCACCTCAGCGAGTTCCGCTACCAGAAGTTCGACGAGGTCGAGATCCCGGGCCAGTATCTCCAGCAC
AAGGACAAGAACCAGGACTTTGTCCAGATCGAACGCTTCCTCCCCAACGTCGACCTCGTGCGGTCCTACAGCGCC
TCGTACCGTCGTCTCAAGATGCGCGGTCACGACGGCAGCGTCCATGCCTGGGCTGTCCAGCATCCAGCCGCCAGA
CACTGCCGCCGCGAGGAACGCATCCTCCAGCTCTTCCGCCAGCTCAACCAGACGCTCGGCCGCAAGAAGGAGAGC
CGTCGTCGGAGCCTCGAGTTCACGCTGCCCGTCATGGTGCCCCTGGCGCCGCACATCCGCATCGTGGCCGAGGAC
ACGTCGTACGTCACCCTCCAGGCCGTCTTCGAAGACCACTGCCGTCGCCACGGCCAGGCAAAGGACGATCCCGTC
CTCTACACGCTCGAGAAGCTCCGCGGCGTCCTCGACTCGGACAGCCCGCAGGCCAAGCTCGAGCTCACGCCCTCG
GCCCGTCTCGAGGTCCTGCAGGCCGTCCAGGACAAGTGGGTGCCCCAGACGACGGCCCTCGACTACTTCCAGCTC
GTCTTCCCCCAGTTCGCAGAGTTCTGGCTCTTCCGTCGCCAGTTCTCCTACCAGCTCTCGGCCCTCTCCTTCATG
ACGTACATCCTCTACATGCACAACCGCTACCCGTCAAAGATGAGCATCGCCCGCGCCTCGGGCAACATCTGGGGC
TCGGAGCTCATGTCCTTCATGAACCCGCACAAGCCCTTCTTCACCAACCCGGAGCCCGTCCCCTTCCGCCTGACC
CCCAACCTCCAAGTGCTGATGGGGCCCCTCGCCACCGAGGGCATCTTCGCCTGTGCGGTAATGGCCATCGCCCGC
TCCCTCACCGAACCGGAAGACGAGCTCGAGCACGCCCTCACCCTCTTCGTCCGCGACGAGATGATCTTTTGGCTC
ACCAGCAGCCATCGCTCCGCCATCAGCGAGTCTCAGCTGAGGGATTCGGTGCAGCTGAATAGCGATTCCATCGTC
AAGCGCGCGGCGAGTCTGGCCAGGAACCCTTCGGGCAATTTACCCGCCAACCAGACCGTCATCGACGCCGTGGCC
AAGGCTGTGAATCCGATGAATCTGGCGCAGTGCGATGCTCTGTGGATGCCGTATCTGTGA
Transcript >Ophun1|3277
ATGGCGGGAACAACCATCGACGACGTCGTGAGACGCCTCAGCACCGCCGATCTAGATGCGAGGCTGAAGCTCGAG
GCTGCCACAACGTTACGCGATAGTCTAGATCATTACACCAGCGGTTCGATATACCCACCCTTCCTCAAACGACTT
GTCCCCATCTTCGTCAATATCCTACGCGGGCCGCCCATCTTTCAGAGCAACTCGGCGGAACAGAAACTCCGTCAC
TGTGTCCTCGAAGTCCTCCACCGATTGCCGACCCAGCCTGCGCCGACCGAGCCGTTCGAGCCATACGCCGAGGAA
GTCTGCGATTTGCTCATGCACCTCGTCCGCACCGACAACGAAGACAACGCGACACTATGTATCAAGATAACTTCC
GACATCATGCGCCACCAGCACAAGGTCCTCCAGGGCAAGGTCCAGACCTTTCTCTCCCTTATCCAGGAGCTCTTC
GAGCAGATGGACAAGGTCGTGCGCGAGCAGCTCGACAACGCGCCATCCGTCGCCTCCTCGCAGCCTGGAGCCCCG
TCGACGCCGGGAAGCTCGCAGATGAGCTTCCAGTCGCCCCGGCCCGGCTCGCCCGTGGCGTCCGTCTCGGACTTG
GGCGCCGATCCCCAGCAGCAGAACCGCTCTCTCTTGCGGGGCATGCAATCGTTCAAGGTCCTTTCCGAGTGCCCC
ATCATCGTCGTTTCCATCTTCCAAATCTATCGCTCGACCGTCGCCCAAAACGTCAAGGCCTTTGTCCCTCTCATC
AAGGGCGTGCTGCTGCTCGAGGCCAGCGCCCAGAGACAGGCCCATGCCGACGCTGCCGCCAAGGGGCAAATCTTC
ACCGGCGTGAGCCCGGCCATCAAGAACAGGGCTGCTTTCGGAGAGTTCATCACGGCTCAGGTCAAGACGATGAGC
TTCCTGGCCTACCTCTTGCGCCAGTACTCGCAGCAGCTGACGGATTTCTTGCCGACGCTGCCCGATGTCGTCGTC
CGGCTGCTGAAAGACTGCCCGCGTGAAAAGTCGGGGACCAGAAAGGAGTTGCTCATCGCCATTAGACACATCATC
AACTACAACTTTCGCAAGATATTCCTCCCCAAGATCGACGAATTGCTGGACGAGAGAACCCTGACCGGCGACGGC
TTGACTGTCTACGAGACTATGCGTCCCTTAGCGTTCAGCATGTTGGCCGATCTCATACACCACGTCCGAGACTCT
CTGAGCCCGGAGCAGATCCGCAAGACCGTCGAGGTCTACACCAAGAATCTGCAGGACAACTTCCCCGGCACCAGC
TTTCAGACCATGAGTGCCAAGCTCCTCCTCAACATGGCAGAGTGCATCGCCAAGCTGCCCAACAAGGTGAACGCG
AGGCATTACCTCATCATGATCCTCAACGCCATCGCCGACAAGTTTGCCGCCATGAACCGCCAGTATCCCAACGCG
GTCAAGCTCTCGAAGCAATATCATCAGCAGGCGGCAGCGGGCACGCCCGAGTCGTATCTGGCCGACAAGGATTGT
CCGCCTGATTGGGACGAGACGGACATCTTCTCCGCCGTGCCCATCAAAATCTCCAACCCTCGCGATCGGGGCGCC
GACCCTCTGGTAGACAACAAGTTCCTCTTCAGGAACCTGCTGAATGGTCTTAAGAATACCTTCTACCAGTTGCGG
ACGTGCAACATTGGCAGCCCCATCGATCCCGAGAACGCGCCGTCGCATTGGCAGGATGTCTCGTATGGCTTCACG
GCTGAGGAAGTCAACGTCATCATCAAGTTGTTCAGGGAGGGCACCTACGTCTTTCGATACTACGAGATTGAGAAG
CCCGCTTCCGAGTCTCAGTACATGTCGCCGGTGGAATACATGGCCAACTTCTACATGGTGTCGAGCAGCAAGGAA
GAAAAGGACTTGATAGAGACATTCGCCACCGTCTTTCACTGCATCGACCCTGCGACGTTCCACGAGGTGTTCCAG
CAGGAGATTCCTCGGCTGTACGACATGATCTTTGAGCACACGGCCCTCCTGCACATACCGCAGTTCTTCCTCGCC
AGCGAGGCTACGTCGCCGAGCTTCTGCGGTATGCTGCTGCAGTTTCTCATGGAGCGCATCGACGAGGTCGGATCG
GCCGACGTCAAGAAGTCGTCTATTCTGCTGCGGCTCTTCAAGCTAGCCTTCATGGCCGTCACCCTATTCGCCGGA
CAGAACGAGCAAGTTCTCCTCCCTCACGTCGTCAACATCGTGACCAAGTCCATCGAGCTCTCCACCAAGGCGGAG
GAGCCCATGAACTACTTTCTCCTTTTGCGCTCTCTGTTCAGAAGCATAGGGGGCGGGAAATTCGAGCAGCTCTAC
AAGCAGATCTTGCCTTTGCTGGAGATGCTCCTGGACGTTCTCAACAACCTTCTCATGGCTGCGCGGAAACAGTCG
GAGCGGGATCTGTACGTGGAGCTGTGCCTCACCGTTCCTGCCCGTCTCAGCCACCTGCTTCCGCATCTGAGCTTC
TTGATGAGGCCCCTCGTCGTGGCTCTGCGAGCGGGAACAGATCTCGTTGGTCAGGGGTTGCGGACATTGGAGTTG
TGTGTGGACAACCTGACGGCCGATTACCTGGATCCCATCATGGCACCAGTCATCGACGAGCTCATGAATTCCCTC
TTCAACCACCTCAAGCCGCACCCCTACAGCCACTTCCACGCCCACACCACCATGAGGATCCTGGGCAAACTCGGG
GGGAGGAATCGCAAGTTTATGTCGGGCGCTGTGCCTCTCACCTGCAAACCCTACGCCGACGACTCGAGCAGCTTC
GACGTCCGCCTCATCGGATCCAAGAAGGATCGGGCCTTTCCGGCAGATCTCGGCATCGACTCCGCCATCCAGAAA
CTCATGGAGGCCCCCAAGATGGGGAAGAGCAGCCAGAATCGCCAGTACGACGAGTACTACAAGAAGCAGGCCGTT
CACTTCATCATCGCTCAGCTCAAGCTGCGGATTGGCTACGACCAGTTGCCGGAAGACTTGCCGAGAATCGTTCGC
CTTCAGGCTCAGGATCTCATGACCCGCAAGATGGACTTTAATTTTGCGCCGTTTGAGGCCTCGAACCGCGACAAG
TCCATTGCGAAAAAGGACGAGCAGGATAAAATCACCAAGCAGCTGATTAAGGCCGTCATGTTCTCGCAGACGATA
CCGGCCTTCAAGGACGAAGCCGACGCGTTTCTCCTCGATGTCTGCAGGCACTTTGCCATCATCGAGGTGGGGCGC
TCTCTCGTCGACATCAAGCGCAGCGTCAGTCCCTTTGATCCTAGAGCCGGCGAGGGCCCCCTGCACATCGAGACG
AGGGTCTTGTCGGACGCAATCGTCGAGTCCCTGGCGTCTGACCACCCGGACTTGCGCGAGGCGGCCAAGCGGGCC
ATCCGAGAGCTCTACCAATGCTCGGCCGTCATCTTCGGCTCCGAGGTCAACGTCGGCCGTCTGCCCCTTTTCAGC
CATCTCAGCAGCACCTTTTGCCACAGCTGCTACGAGGAGGAATGGTTCACCAAGACCGGAGGTAGCCTGGGCATC
AACTTTCTCCTCACCGAGCTGGACTTTGGCGATGCCTGGGTGGCGTCCAAGCAGACGGAGTTCATCCGCGCCCTC
ATGTACGTCATCAAGGACATGCCTCAGGATCTTCCGGAGAGGACTAGGTGTCTGGCCCAGACGAGCCTCGAGGTT
CTCCTGAGACGCATCACCAAGAACATCAAAAAGGAAGACGCCCTGCCCGTCTTCCAGCCGCCCGGTCAGCCGCCC
GTCAAGCAGCCGCGGCTCGCGCAGATCTGCCTGCAGTTCAACAACGAGCTCTCGCATATGAACAAGTTCGTCCGC
GAGACGGCCAGACTCTCGCTCGAGTCCGTGGCCAAGGCTGCCGGCTGCGAGGTGTGGGAGCTCGTCGAGCCCTAC
AGGGAGAGGTTTCTGCAACCCATCTACTCCAAGCCCCTGCGCGCGCTGCCATTTAGCATCCAGATCGGGTACATC
AACGCCATGACGTATCACATGAGCCTCAAGAGCGAATGGGTCAAGTTCGACGACAACCTGAACCGGCTGCTCATG
GAGTCTCTGGCCCTGGCGGACGCAAATGATGAATCGCTGGCCAACAAGCCCGCCGAGTACCGCACGCACGAGCAC
ATTGTGACGCTGAGGATCTCATGCATCAAATTGCTCAGTACGGCCATGACGTTTGAGGAGTTTGCCAACAACCCG
ACCAAGGGCAAAATTTTGGCCGTCTTCTTCAAGTGCCTATACTCGGAATCGAAGCCGACCATCGATGCGGCTAAC
GACGCGTTGCGGTCGGTCCTGGCCGTCGACAGGCGTCTGCCCAAGGACCTGCTGCAGGGAGGCTTGCGTCCCGTG
TTGCAGAGTCTATCGGACCCGAAGCGCTTGACGACGCATGGTCTGGACAATCTCTCGAGGCTGCTGAAGCTCTTG
ACCAGCTATTTCAAGGTCGAGATTGGTTCCCGCCTCCTCGATCAGATTGATTCCATCCTGGACCCCGGGCAGTTG
CAGCAGATGTCGTTTACCTTTTTCGAGCAGAATCCGCAGATGAAGGTCATCGTTGCTATCTTCAACATCTTTCAC
CTGTTGCCGTCTCAGGCTGAGGCGTTCAAAGAAGCCCTCATCGACAGCTTTCTTAGCTTGGAAGAGAAGCTCAGG
AGGACGATTCACAGCCCGTTCAGGCAGCCCATGTACCTCTATCTGAATAGGTACCCGAAGGAGGTCTGGGGCTTC
CTCGTCGGTCGACTGGACGACCTCAAATACGGGCGACTGCTGGCCCAAGTCTTGCGGCACCCGGACAGCGGTCCT
CTCCGAGAAGTGGCGACGGAAAAGGTGGACGCCTTGATGCAGAGGTGCAACGAGGCAGCGTCTCAGGGGGTCGAC
AAGAAGTTTACGGCCATCGTCAACACGGTGCACGTGCTCGACTCGATAAGCCAGTGGACGTCTAACAACGGCTGG
ATGGATAGGAGGGACTGCATCGCGTGGCTCAAGACGGTCGGCAAAGACTTGGAGAGTCATCTCGGTGGCTACGCG
TTGCCGGCCAACCTCCGGCTTCCGGCCTACCAGGCGGCGGAGCAGCTGATGGGCATCCTGGTCAAGTCGCTCCAC
AGGAACCCGAGGGATCTGGACGCGCTGTTCAACCTGATTGAGTCGGTGACGACGGAGGAGCTCAGGCCGACGCAT
GCGCTCTTCTCGTTCATCTACGCCAGAATCATCTGCAGCGAGTCCATCGACTTTTGGAAAACGACCTTCTTGCGG
TGCCTCGACATGTATTCGAGCAAGACGACGCTCAACAAGACGAAGCACTTTTTGTTGCACTACATCGTCAGCCCC
ATCGTCGCCATGGACGTGATGCGTCACTGGAACCAGCCGGAGTCGGGCAGGCCGCAGCGGCTCATGGACCGGAGC
GTCATCGACGCCGTCAGCTCGAGGATATGGAAAGTTCATCCGGAGATGGCGGCCGACGACCAAGCACAGCCAGGA
ATCGACCATACGAGGTTCGAGGTCCTCCAACTGTCTGCGATGCTGGTCAAGTATCACCACGTGCTACTGCAAGAG
GCGCGCAAGGACATCATCAAGTTTGGATGGACCTTTATCCGGCTCGACGACGTCATCAACAAGCACGCGGCGTAC
GTGGTCATCGGCTACTTCATCGCCCATTACGAGACGCCTCCCAAGATCGTCAACCAGGTCTACATCTCGCTGCTC
AAGACGAACCAGAACGAGGGGAGGGCGCTGGTGACGCAGGCGCTGGAGCTCATCGCCCCCGTGCTTCCCAAGCGG
TGCGGCAGCGGTCCCAACGAGCGCAACGCGGCCTGGGCGGTGGCGCCGCGGCGGATCCTGGCCGACGAGGGCCAG
AACGTGCAGCAGATGACGAGCATCTTTCACTTCCTGGTGCGGCATCCGGATCTGTTCTTCGACGCGCGGGACAAG
TACGCCATCCTGCTCATCACGTCGCTCAGAAAGGTGGCGGCGCCGCCGAATCCGTCTCACGAGAGCAGGAAGCTG
GCTCTTAACATGATGTGGCTCATCTGGACTTGGGAGCAGTGGCGCGTCGAGGGCGGGCGGCCTTCTGTTCGGGAC
TCGTCTCAGTCGCCGACTTCACGGAAGCGCAAGTTCGAGGCCGACGTGTCGCCGACGACGGTGAGGCAGCAGCAG
CAGCCCCTGGCCAACGAATATCAGATCCCGCCCGTGTTCCGGCAGAAGATGATCAAGTATCTGGTCGAGTTCATC
GCCCAGCTGAACGAGCGATATCATCTGCCATCGGCGAAGCCCCGTGAACTGAACCCGGCGACGATTCCGCTGCCG
CCGCCCAACACGGAGCTCTGCAAGAAGGCCATGAGCCTGCTGTACAATCTCGTGCAGCCTCGGTACTGGGGCGAT
CTTGAGCTCGACCTATTCCCCAATGTTACGGACGTGATCCTGGGGAGCGATAAGACGCAGGTCATCCTCAACGCC
GACCCAGCCGATAAGGAAAAGTACGACGAGAGGTTCCTGACCAACATCATCAACACGCTGCAGGTGGTGCGCATC
GTGCTCAACTTCAAGTCGGACGAGTGGGTGCAGAAGAACATGGCGGCGGTGCAAAAGGTGCTGGAGAAGTGCCTC
CGATGCGAGAATGCCGAGATCCAGGACTGCCTGCACCTGGCCGACAGCAACTACGACGACGAGCGCGAGCTCCGG
TCCATCATCCAGCGCGTGCTCGATGCCGTGCCCGAGGACACGCCCATGGAGGACGCCGAGGCAGAGACGGAAGCA
GAGGCGCAGACGTCGGAGATTGTGTCGTACCTCTCGCAGGCGGCGACCGAGGCCATGAACAACGGATCGTACATC
TCGGGCGTCAACCTCCTCTGGTCGCTGGGAAAGCGGAAGCCGGCCGTCATCGACCAGCACGTGGCGTCGCTCATG
AAGGCTCTGCAGAGCAAGCACGCCAGGGAGCACGTGCAGTATTACAACGCCGTGGCCAGCCAGGCGGCGGCGGCC
GGCAGCCGAGGCCAGGATGGGGCTCCGGCGGCGAACGAGATGGCGGCTTACGACCTGGAGATACAGACGAAGCTG
ATCATCAAGGAGATCCAGACGGTGGCGCTGCGGATGGAGCACCTGGGCGACAACCGGAGGCCGTTTCTCAGCGTG
CTGGCGACGCTGGTGGAGAAGTCGATGCACATTGAGCTCTGCAGCGAGATACTGGCCATGGTCGAGGGCTGGGTG
TTTCGATCCGAAGGGACGTGGCCGACGCTCAAGGAGAAGACGGCGGTGCTGCATAAGATGTTGTCGTTTGAGCAC
CGGCAGGACTCGACGATGCTGTCCAAGTTCCTCGACCTGGTGATACGCATCTACGAGGACCCCAAGATTACGCGG
ACGGAGCTGACGGTGCGGATGGAGCACGCGTTCCTCATCGGCACGAGGGCAGCCGACGTCGAGATGCGCAACCGG
TTCATGGCCCTGTTCGACAAGAGCCTGTCGCGGACGGCGAGCCTGCGGTTCGCGTACGTGCTGACGAGCCAGAAC
TGGGACACGCTGGCCGACTCGTACTGGCTGGCGCAGGCGTCGCAGTTTATGCTGGGCGGCATCGACGGCGGCACG
GGCATCCACCTTGACGCCGAGGACTTCCGGGTGACGCCGCTGTCGGAGCTGGCGGCGGTGTTCCCCCGGGATCGG
GAGCCCCGGGCGGCGACGGACGACAAGCTCGAGGGGCTGATGGCGGGCCACCGGCGGTTCGTGGCGGAGCTGGGC
GACGTCAAGGTGCGAGACGTGCTGGAGCCCCTGATGCAGCTACAGCACGTCGATACGGCGCTGGCTCATCAACTC
TGGGTGGTCGAGTTCCCGCTCTTCTGGTCGGCGACTCTGCGCGAGGACAGGGCCGAGCTGGAGCGAGGCATCGTG
GCCCTCCTGACCAAGGACTACCACAGCCGACAGCTGGACAAGCGACCCAACGTGATGCAGTCGCTGGTCGAGGGC
TGCGTCAAGACGTGGCCTCAGTGCAAGCTCCCACCACACGTGCTCAAGTTCGAGGCCAAGACGTTTGACGTGTGG
TACGCGGCCATGGTGCAGCTGGAACGGGCGGCCATCAGGCCCGAGACGGACTCGGCCACGGTACGGGAGAGCAAC
CTGGACGCGCTGCTGGATCTCTACGCTGCGCTGCAGGAGGAGGACCTCTTCTACGGCACTTGGAGGCGACGCTGC
CAGTTCGTCGAGACCAACGCGGGCCTGTCGTACGAGCAGAGCGGCATGTGGGATAAGGCGCAGCGGCTGTACGAG
ACGGCGCAGGTCAAGGCGAGGACGGGCGTGATTCCCTTCTCGCAGGCCGAGTACATGCTGTGGGAGGATCACTGG
GTGCTGTGCGCTCAGAAGCTGCAGCAGTGGGAGATTCTTCACGACTTCGCCAAGCACGAGAACTTCCAGGACCTG
CTGCTCGAGTGCGCGTGGCGGAACACGGACATGTGGCAGGACGCCCAGCACCGCGAGGTGCTCGATAACGTCATT
AAGGGAGTCATGGACGCGCCGACGCCGCGGAGGGCCTTCTTCCAGGCCTTTATGTCGCTGCTCAAGTTCCACAAC
CAGCAGGAGAACGCGCTGGAGTTGGCACGCGTGTGTGACGAGGCCATTCAGCTGTCGATCCGCAAGTGGCACCAG
CTTCCGGAGCGGCTCACGCAGGCGCATGTTCCGCTGCTGCAGAACTTCCAGCAGCTGGTCGAGATGCACGATGCC
AGCGTCATCTGCCAGAGCCTGGCCAGCACCAACGCGGGCAACCTCGACGTCAAGTCGGGCGAGCTCAAGCTGCTT
CTGGGCGCCTGGCGAGATCGGCTGCCCAACGTGTGGGACGACATCACGGCCTGGCAGGACTTGGTATCGTGGCGG
CAGCACATCTTCAGCCTCATCAACCAGACCTACCTCCAGCTGCTGCCGCCTCAGGCTCAGCAGAACGCGGGAGGC
GCCAACTCGTTCGCCTACCGCGGCTATCACGAGACGGCCTGGATCATCAACCGCTTCGCCCACGTGGCGCGCAAG
CACAGCCTGCCCGAGGTGTGCATCAGCCAGCTCAGCCGCATCTATACGCTGCCCAACATTGAGATTCAGGAGGCC
TTTTTGAAGCTGCGCGAGCAGGCCAAGTGTCACTACGAGAATGCCGACGAACTGTCAAGCGGGCTCGACGTCATC
AACAACACCAACCTCAACTACTTCAACCCGCAGCAAAAGGCCGAGTTCTATACGCTCAAGGGCATGTTTCTCGAG
AAGCTCAAGCACAAGGACGAGGCCGACAACGCCTACGGAACGGCCCTGTACTTTGATATAGGAGCGGCAAAGGCC
TGGGCTGAATGGGGTCACTTCAACGACCGCAAGTTCAAGGAGGAACCGTCGGATCTCAACGCGGCGCGTCAGGCT
CTGACGTCGTATCTCCAGGCGGCCGGCAGCTACAAGAACGCCAAGTCGCGCAAGCTGCTGGCCCGGATCCTGTGG
CTGCTGAGCCTCGACGACGCCAAGGGAACCATCGCCATGGGCTTCGACGACTTCAAGGGCGAGACGCCCGTTTGG
TACTGGATCACGCTCATCCCCCAGCTGCTGACGGGGCTGGGCCACAAGGAGGCGCCTCGCGTCTATCAGATCTTG
CTGAGCATCGCCAAGTCGTACCCGCAGGCGCTGTACTTTCAACTGCGAACCAACCGCGAGGACATGCACGTCATA
CGCAAGAGTCAGGAGACCAAGGAGCGGGCGAGGCAGCAGCGGGCTTCCAGCAGCAACATGTCGCCGACGAAGGCC
GAAGCCGACGCCGAGGTCAAGGCTGAGAACGCGGCCGATGGTGCAGAAGGGGGCGGTTCGACGACGACGACGACG
GATCAACACCAGCAGCAGCAGCAGCAGCAACTTCAACAGAAGAAGCCACCGTGGGAACTCACAGAGGAGATCATG
TCGGTCCTCAAGACGGCCTTCCCCCTGCTGGCCCTCTCCATGGAGGCCATGGTGGACCAGATCCAGAAGCACTTC
AAGTGTCCGCCCGACGAGGACGCCTACAGGCTCATCGTGGCCCTCCTCAACGACGCCCTCACCTACGTCAGCCGC
ACGCCGGCCTCGTTTGCCCGCAGCGTCAAGTTGCCTGCCGCCACCGAGACCAACATCACGCGCTTCGCCGAGACG
ATCCTACCGACTCACATCAAGAAGTCGTTTGAGAAGGACTTTGTCGAGGTCAAGCCCACCATGTACGAGTACATC
CACAAGCTGCGACGATGGCGTACCAAGTTCGAGGAGAAGCTGGACAGACGCGTCGCCCACGCGCCCCTCGAGGCC
TTTTCTTCCCACCTCAGCGAGTTCCGCTACCAGAAGTTCGACGAGGTCGAGATCCCGGGCCAGTATCTCCAGCAC
AAGGACAAGAACCAGGACTTTGTCCAGATCGAACGCTTCCTCCCCAACGTCGACCTCGTGCGGTCCTACAGCGCC
TCGTACCGTCGTCTCAAGATGCGCGGTCACGACGGCAGCGTCCATGCCTGGGCTGTCCAGCATCCAGCCGCCAGA
CACTGCCGCCGCGAGGAACGCATCCTCCAGCTCTTCCGCCAGCTCAACCAGACGCTCGGCCGCAAGAAGGAGAGC
CGTCGTCGGAGCCTCGAGTTCACGCTGCCCGTCATGGTGCCCCTGGCGCCGCACATCCGCATCGTGGCCGAGGAC
ACGTCGTACGTCACCCTCCAGGCCGTCTTCGAAGACCACTGCCGTCGCCACGGCCAGGCAAAGGACGATCCCGTC
CTCTACACGCTCGAGAAGCTCCGCGGCGTCCTCGACTCGGACAGCCCGCAGGCCAAGCTCGAGCTCACGCCCTCG
GCCCGTCTCGAGGTCCTGCAGGCCGTCCAGGACAAGTGGGTGCCCCAGACGACGGCCCTCGACTACTTCCAGCTC
GTCTTCCCCCAGTTCGCAGAGTTCTGGCTCTTCCGTCGCCAGTTCTCCTACCAGCTCTCGGCCCTCTCCTTCATG
ACGTACATCCTCTACATGCACAACCGCTACCCGTCAAAGATGAGCATCGCCCGCGCCTCGGGCAACATCTGGGGC
TCGGAGCTCATGTCCTTCATGAACCCGCACAAGCCCTTCTTCACCAACCCGGAGCCCGTCCCCTTCCGCCTGACC
CCCAACCTCCAAGTGCTGATGGGGCCCCTCGCCACCGAGGGCATCTTCGCCTGTGCGGTAATGGCCATCGCCCGC
TCCCTCACCGAACCGGAAGACGAGCTCGAGCACGCCCTCACCCTCTTCGTCCGCGACGAGATGATCTTTTGGCTC
ACCAGCAGCCATCGCTCCGCCATCAGCGAGTCTCAGCTGAGGGATTCGGTGCAGCTGAATAGCGATTCCATCGTC
AAGCGCGCGGCGAGTCTGGCCAGGAACCCTTCGGGCAATTTACCCGCCAACCAGACCGTCATCGACGCCGTGGCC
AAGGCTGTGAATCCGATGAATCTGGCGCAGTGCGATGCTCTGTGGATGCCGTATCTGTGA
Gene >Ophun1|3277
ATGGCGGGAACAACCATCGACGACGTCGTGAGACGCCTCAGCACCGCCGATCTAGGTATGGCATCCCCTCCCTTG
GTCGCAAACGAGCGGGACTGACGCCTTCGCCTTGCAGATGCGAGGCTGAAGCTCGAGGCTGCCACAACGTTACGC
GATAGTCTAGATCATTACACCAGCGGTTCGATATACCCACCCTTCCTCAAACGACTTGTCCCCATCTTCGTCAAT
ATCCTACGCGGGCCGCCCATCTTTCAGAGCAACTCGGCGGAACAGGTAAGGCTTTGCTTTCTCGTCTTGTTCGCT
TAGCTGACGCTCAACCACAGAAACTCCGTCACTGTGTCCTCGAAGTCCTCCACCGATTGCCGACCCAGCCTGCGC
CGACCGAGCCGTTCGAGCCATACGCCGAGGAAGTCTGCGATTTGCTCATGCACCTCGTCCGCACCGACAACGAAG
ACAACGCGACACTATGTATCAAGATAACTTCCGACATCATGCGCCACCAGCACAAGGTCCTCCAGGGCAAGGTCC
AGACCTTTCTCTCCCTTATCCAGGAGCTCTTCGAGCAGATGGACAAGGTCGTGCGCGAGCAGCTCGACAACGCGC
CATCCGTCGCCTCCTCGCAGCCTGGAGCCCCGTCGACGCCGGGAAGCTCGCAGATGAGCTTCCAGTCGCCCCGGC
CCGGCTCGCCCGTGGCGTCCGTCTCGGACTTGGGCGCCGATCCCCAGCAGCAGAACCGCTCTCTCTTGCGGGGCA
TGCAATCGTTCAAGGTCCTTTCCGAGTGCCCCATCATCGTCGTTTCCATCTTCCAAATCTATCGCTCGACCGTCG
CCCAAAACGTCAAGGCCTTTGTCCCTCTCATCAAGGGCGTGCTGCTGCTCGAGGCCAGCGCCCAGAGACAGGCCC
ATGCCGACGCTGCCGCCAAGGGGCAAATCTTCACCGGCGTGAGCCCGGCCATCAAGAACAGGGCTGCTTTCGGAG
AGTTCATCACGGCTCAGGTCAAGACGATGAGCTTCCTGGCCTACCTCTTGCGCCAGTACTCGCAGCAGCTGACGG
ATTTCTTGCCGACGCTGCCCGATGTCGTCGTCCGGCTGCTGAAAGACTGCCCGCGTGAAAAGTCGGGGACCAGAA
AGGAGTTGCTCATCGCCATTAGACACATCATCAACTACAACTTTCGCAAGATATTCCTCCCCAAGATCGACGAAT
TGCTGGACGAGAGAACCCTGACCGGCGACGGCTTGACTGTCTACGAGACTATGCGTCCCTTAGCGTTCAGCATGT
TGGCCGATCTCATACACCACGTCCGAGACTCTCTGAGCCCGGAGCAGATCCGCAAGACCGTCGAGGTCTACACCA
AGAATCTGCAGGACAACTTCCCCGGCACCAGCTTTCAGACCATGAGTGCCAAGCTCCTCCTCAACATGGCAGAGT
GCATCGCCAAGCTGCCCAACAAGGTGAACGCGAGGCATTACCTCATCATGATCCTCAACGCCATCGCCGACAAGT
TTGCCGCCATGAACCGCCAGTATCCCAACGCGGTCAAGCTCTCGAAGCAATATCATCAGCAGGCGGCAGCGGGCA
CGCCCGAGTCGTATCTGGCCGACAAGGATTGTCCGCCTGATTGGGACGAGACGGACATCTTCTCCGCCGTGCCCA
TCAAAATCTCCAACCCTCGCGATCGGGGCGCCGACCCTCTGGTAGACAACAAGTTCCTCTTCAGGAACCTGCTGA
ATGGTCTTAAGAATACCTTCTACCAGTTGCGGACGTGCAACATTGGCAGCCCCATCGATCCCGAGAACGCGCCGT
CGCATTGGCAGGATGTCTCGTATGGCTTCACGGCTGAGGAAGTCAACGTCATCATCAAGTTGTTCAGGGAGGGCA
CCTACGTCTTTCGATACTACGAGATTGAGAAGCCCGCTTCCGAGTCTCAGTACATGTCGCCGGTGGAATACATGG
CCAACTTCTACATGGTGTCGAGCAGCAAGGAAGAAAAGGACTTGATAGAGACATTCGCCACCGTCTTTCACTGCA
TCGACCCTGCGACGTTCCACGAGGTGTTCCAGCAGGAGATTCCTCGGCTGTACGACATGATCTTTGAGCACACGG
CCCTCCTGCACATACCGCAGTTCTTCCTCGCCAGCGAGGCTACGTCGCCGAGCTTCTGCGGTATGCTGCTGCAGT
TTCTCATGGAGCGCATCGACGAGGTCGGATCGGCCGACGTCAAGAAGTCGTCTATTCTGCTGCGGCTCTTCAAGC
TAGCCTTCATGGCCGTCACCCTATTCGCCGGACAGAACGAGCAAGTTCTCCTCCCTCACGTCGTCAACATCGTGA
CCAAGTCCATCGAGCTCTCCACCAAGGCGGAGGAGCCCATGAACTACTTTCTCCTTTTGCGCTCTCTGTTCAGAA
GCATAGGGGGCGGGAAATTCGAGCAGCTCTACAAGCAGATCTTGCCTTTGCTGGAGATGCTCCTGGACGTTCTCA
ACAACCTTCTCATGGCTGCGCGGAAACAGTCGGAGCGGGATCTGTACGTGGAGCTGTGCCTCACCGTTCCTGCCC
GTCTCAGCCACCTGCTTCCGCATCTGAGCTTCTTGATGAGGCCCCTCGTCGTGGCTCTGCGAGCGGGAACAGATC
TCGTTGGTCAGGGGTTGCGGACATTGGAGTTGTGTGTGGACAACCTGACGGCCGATTACCTGGATCCCATCATGG
CACCAGTCATCGACGAGCTCATGAATTCCCTCTTCAACCACCTCAAGCCGCACCCCTACAGCCACTTCCACGCCC
ACACCACCATGAGGATCCTGGGCAAACTCGGGGGGAGGAATCGCAAGTTTATGTCGGGCGCTGTGCCTCTCACCT
GCAAACCCTACGCCGACGACTCGAGCAGCTTCGACGTCCGCCTCATCGGATCCAAGAAGGATCGGGCCTTTCCGG
CAGATCTCGGCATCGACTCCGCCATCCAGAAACTCATGGAGGCCCCCAAGATGGGGAAGAGCAGCCAGAATCGCC
AGTACGACGAGTACTACAAGAAGCAGGCCGTTCACTTCATCATCGCTCAGCTCAAGCTGCGGATTGGCTACGACC
AGTTGCCGGAAGACTTGCCGAGAATCGTTCGCCTTCAGGCTCAGGATCTCATGACCCGCAAGATGGACTTTAATT
TTGCGCCGTTTGAGGCCTCGAACCGCGACAAGTCCATTGCGAAAAAGGACGAGCAGGATAAAATCACCAAGCAGC
TGATTAAGGCCGTCATGTTCTCGCAGACGATACCGGCCTTCAAGGACGAAGCCGACGCGTTTCTCCTCGATGTCT
GCAGGCACTTTGCCATCATCGAGGTGGGGCGCTCTCTCGTCGACATCAAGCGCAGCGTCAGTCCCTTTGATCCTA
GAGCCGGCGAGGGCCCCCTGCACATCGAGACGAGGGTCTTGTCGGACGCAATCGTCGAGTCCCTGGCGTCTGACC
ACCCGGACTTGCGCGAGGCGGCCAAGCGGGCCATCCGAGAGCTCTACCAATGCTCGGCCGTCATCTTCGGCTCCG
AGGTCAACGTCGGCCGTCTGCCCCTTTTCAGCCATCTCAGCAGCACCTTTTGCCACAGCTGCTACGAGGAGGAAT
GGTTCACCAAGACCGGAGGTAGCCTGGGCATCAACTTTCTCCTCACCGAGCTGGACTTTGGCGATGCCTGGGTGG
CGTCCAAGCAGACGGAGTTCATCCGCGCCCTCATGTACGTCATCAAGGACATGCCTCAGGATCTTCCGGAGAGGA
CTAGGTGTCTGGCCCAGACGAGCCTCGAGGTTCTCCTGAGACGCATCACCAAGAACATCAAAAAGGAAGACGCCC
TGCCCGTCTTCCAGCCGCCCGGTCAGCCGCCCGTCAAGCAGCCGCGGCTCGCGCAGATCTGCCTGCAGTTCAACA
ACGAGCTCTCGCATATGAACAAGTTCGTCCGCGAGACGGCCAGACTCTCGCTCGAGTCCGTGGCCAAGGCTGCCG
GCTGCGAGGTGTGGGAGCTCGTCGAGCCCTACAGGGAGAGGTTTCTGCAACCCATCTACTCCAAGCCCCTGCGCG
CGCTGCCATTTAGCATCCAGATCGGGTACATCAACGCCATGACGTATCACATGAGCCTCAAGAGCGAATGGGTCA
AGTTCGACGACAACCTGAACCGGCTGCTCATGGAGTCTCTGGCCCTGGCGGACGCAAATGATGAATCGCTGGCCA
ACAAGCCCGCCGAGTACCGCACGCACGAGCACATTGTGACGCTGAGGATCTCATGCATCAAATTGCTCAGTACGG
CCATGACGTTTGAGGAGTTTGCCAACAACCCGACCAAGGGCAAAATTTTGGCCGTCTTCTTCAAGTGCCTATACT
CGGAATCGAAGCCGACCATCGATGCGGCTAACGACGCGTTGCGGTCGGTCCTGGCCGTCGACAGGCGTCTGCCCA
AGGACCTGCTGCAGGGAGGCTTGCGTCCCGTGTTGCAGAGTCTATCGGACCCGAAGCGCTTGACGACGCATGGTC
TGGACAATCTCTCGAGGCTGCTGAAGCTCTTGACCAGCTATTTCAAGGTCGAGATTGGTTCCCGCCTCCTCGATC
AGATTGATTCCATCCTGGACCCCGGGCAGTTGCAGCAGATGTCGTTTACCTTTTTCGAGCAGAATCCGCAGATGA
AGGTCATCGTTGCTATCTTCAACATCTTTCACCTGTTGCCGTCTCAGGCTGAGGCGTTCAAAGAAGCCCTCATCG
ACAGCTTTCTTAGCTTGGAAGAGAAGCTCAGGAGGACGATTCACAGCCCGTTCAGGCAGCCCATGTACCTCTATC
TGAATAGGTACCCGAAGGAGGTCTGGGGCTTCCTCGTCGGTCGACTGGACGACCTCAAATACGGGCGACTGCTGG
CCCAAGTCTTGCGGCACCCGGACAGCGGTCCTCTCCGAGAAGTGGCGACGGAAAAGGTGGACGCCTTGATGCAGA
GGTGCAACGAGGCAGCGTCTCAGGGGGTCGACAAGAAGTTTACGGCCATCGTCAACACGGTGCACGTGCTCGACT
CGATAAGCCAGTGGACGTCTAACAACGGCTGGATGGATAGGAGGGACTGCATCGCGTGGCTCAAGACGGTCGGCA
AAGACTTGGAGAGTCATCTCGGTGGCTACGCGTTGCCGGCCAACCTCCGGCTTCCGGCCTACCAGGCGGCGGAGC
AGCTGATGGGCATCCTGGTCAAGTCGCTCCACAGGAACCCGAGGGATCTGGACGCGCTGTTCAACCTGATTGAGT
CGGTGACGACGGAGGAGCTCAGGCCGACGCATGCGCTCTTCTCGTTCATCTACGCCAGAATCATCTGCAGCGAGT
CCATCGACTTTTGGAAAACGACCTTCTTGCGGTGCCTCGACATGTATTCGAGCAAGACGACGCTCAACAAGACGA
AGCACTTTTTGTTGCACTACATCGTCAGCCCCATCGTCGCCATGGACGTGATGCGTCACTGGAACCAGCCGGAGT
CGGGCAGGCCGCAGCGGCTCATGGACCGGAGCGTCATCGACGCCGTCAGCTCGAGGATATGGAAAGTTCATCCGG
AGATGGCGGCCGACGACCAAGCACAGCCAGGAATCGACCATACGAGGTTCGAGGTCCTCCAACTGTCTGCGATGC
TGGTCAAGTATCACCACGTGCTACTGCAAGAGGCGCGCAAGGACATCATCAAGTTTGGATGGACCTTTATCCGGC
TCGACGACGTCATCAACAAGCACGCGGCGTACGTGGTCATCGGCTACTTCATCGCCCATTACGAGACGCCTCCCA
AGATCGTCAACCAGGTCTACATCTCGCTGCTCAAGACGAACCAGAACGAGGGGAGGGCGCTGGTGACGCAGGCGC
TGGAGCTCATCGCCCCCGTGCTTCCCAAGCGGTGCGGCAGCGGTCCCAACGAGCGCAACGCGGCCTGGGCGGTGG
CGCCGCGGCGGATCCTGGCCGACGAGGGCCAGAACGTGCAGCAGATGACGAGCATCTTTCACTTCCTGGTGCGGC
ATCCGGATCTGTTCTTCGACGCGCGGGACAAGTACGCCATCCTGCTCATCACGTCGCTCAGAAAGGTGGCGGCGC
CGCCGAATCCGTCTCACGAGAGCAGGAAGCTGGCTCTTAACATGATGTGGCTCATCTGGACTTGGGAGCAGTGGC
GCGTCGAGGGCGGGCGGCCTTCTGTTCGGGACTCGTCTCAGTCGCCGACTTCACGGAAGCGCAAGTTCGAGGCCG
ACGTGTCGCCGACGACGGTGAGGCAGCAGCAGCAGCCCCTGGCCAACGAATATCAGATCCCGCCCGTGTTCCGGC
AGAAGATGATCAAGTATCTGGTCGAGTTCATCGCCCAGCTGAACGAGCGATATCATCTGCCATCGGCGAAGCCCC
GTGAACTGAACCCGGCGACGATTCCGCTGCCGCCGCCCAACACGGAGCTCTGCAAGAAGGCCATGAGCCTGCTGT
ACAATCTCGTGCAGCCTCGGTACTGGGGCGATCTTGAGCTCGACCTATTCCCCAATGTTACGGACGTGATCCTGG
GGAGCGATAAGACGCAGGTCATCCTCAACGCCGACCCAGCCGATAAGGAAAAGTACGACGAGAGGTTCCTGACCA
ACATCATCAACACGCTGCAGGTGGTGCGCATCGTGCTCAACTTCAAGTCGGACGAGTGGGTGCAGAAGAACATGG
CGGCGGTGCAAAAGGTGCTGGAGAAGTGCCTCCGATGCGAGAATGCCGAGATCCAGGACTGCCTGCACCTGGCCG
ACAGCAACTACGACGACGAGCGCGAGCTCCGGTCCATCATCCAGCGCGTGCTCGATGCCGTGCCCGAGGACACGC
CCATGGAGGACGCCGAGGCAGAGACGGAAGCAGAGGCGCAGACGTCGGAGATTGTGTCGTACCTCTCGCAGGCGG
CGACCGAGGCCATGAACAACGGATCGTACATCTCGGGCGTCAACCTCCTCTGGTCGCTGGGAAAGCGGAAGCCGG
CCGTCATCGACCAGCACGTGGCGTCGCTCATGAAGGCTCTGCAGAGCAAGCACGCCAGGGAGCACGTGCAGTATT
ACAACGCCGTGGCCAGCCAGGCGGCGGCGGCCGGCAGCCGAGGCCAGGATGGGGCTCCGGCGGCGAACGAGATGG
CGGCTTACGACCTGGAGATACAGACGAAGCTGATCATCAAGGAGATCCAGACGGTGGCGCTGCGGATGGAGCACC
TGGGCGACAACCGGAGGCCGTTTCTCAGCGTGCTGGCGACGCTGGTGGAGAAGTCGATGCACATTGAGCTCTGCA
GCGAGATACTGGCCATGGTCGAGGGCTGGGTGTTTCGATCCGAAGGGACGTGGCCGACGCTCAAGGAGAAGACGG
CGGTGCTGCATAAGATGTTGTCGTTTGAGCACCGGCAGGACTCGACGATGCTGTCCAAGTTCCTCGACCTGGTGA
TACGCATCTACGAGGACCCCAAGATTACGCGGACGGAGCTGACGGTGCGGATGGAGCACGCGTTCCTCATCGGCA
CGAGGGCAGCCGACGTCGAGATGCGCAACCGGTTCATGGCCCTGTTCGACAAGAGCCTGTCGCGGACGGCGAGCC
TGCGGTTCGCGTACGTGCTGACGAGCCAGAACTGGGACACGCTGGCCGACTCGTACTGGCTGGCGCAGGCGTCGC
AGTTTATGCTGGGCGGCATCGACGGCGGCACGGGCATCCACCTTGACGCCGAGGACTTCCGGGTGACGCCGCTGT
CGGAGCTGGCGGCGGTGTTCCCCCGGGATCGGGAGCCCCGGGCGGCGACGGACGACAAGCTCGAGGGGCTGATGG
CGGGCCACCGGCGGTTCGTGGCGGAGCTGGGCGACGTCAAGGTGCGAGACGTGCTGGAGCCCCTGATGCAGCTAC
AGCACGTCGATACGGCGCTGGCTCATCAACTCTGGGTGGTCGAGTTCCCGCTCTTCTGGTCGGCGACTCTGCGCG
AGGACAGGGCCGAGCTGGAGCGAGGCATCGTGGCCCTCCTGACCAAGGACTACCACAGCCGACAGCTGGACAAGC
GACCCAACGTGATGCAGTCGCTGGTCGAGGGCTGCGTCAAGACGTGGCCTCAGTGCAAGCTCCCACCACACGTGC
TCAAGTTCGAGGCCAAGACGTTTGACGTGTGGTACGCGGCCATGGTGCAGCTGGAACGGGCGGCCATCAGGCCCG
AGACGGACTCGGCCACGGTACGGGAGAGCAACCTGGACGCGCTGCTGGATCTCTACGCTGCGCTGCAGGAGGAGG
ACCTCTTCTACGGCACTTGGAGGCGACGCTGCCAGTTCGTCGAGACCAACGCGGGCCTGTCGTACGAGCAGAGCG
GCATGTGGGATAAGGCGCAGCGGCTGTACGAGACGGCGCAGGTCAAGGCGAGGACGGGCGTGATTCCCTTCTCGC
AGGCCGAGTACATGCTGTGGGAGGATCACTGGGTGCTGTGCGCTCAGAAGCTGCAGCAGTGGGAGATTCTTCACG
ACTTCGCCAAGCACGAGAACTTCCAGGACCTGCTGCTCGAGTGCGCGTGGCGGAACACGGACATGTGGCAGGACG
CCCAGCACCGCGAGGTGCTCGATAACGTCATTAAGGGAGTCATGGACGCGCCGACGCCGCGGAGGGCCTTCTTCC
AGGCCTTTATGTCGCTGCTCAAGTTCCACAACCAGCAGGAGAACGCGCTGGAGTTGGCACGCGTGTGTGACGAGG
CCATTCAGCTGTCGATCCGCAAGTGGCACCAGCTTCCGGAGCGGCTCACGCAGGCGCATGTTCCGCTGCTGCAGA
ACTTCCAGCAGCTGGTCGAGATGCACGATGCCAGCGTCATCTGCCAGAGCCTGGCCAGCACCAACGCGGGCAACC
TCGACGTCAAGTCGGGCGAGCTCAAGCTGCTTCTGGGCGCCTGGCGAGATCGGCTGCCCAACGTGTGGGACGACA
TCACGGCCTGGCAGGACTTGGTATCGTGGCGGCAGCACATCTTCAGCCTCATCAACCAGACCTACCTCCAGCTGC
TGCCGCCTCAGGCTCAGCAGAACGCGGGAGGCGCCAACTCGTTCGCCTACCGCGGCTATCACGAGACGGCCTGGA
TCATCAACCGCTTCGCCCACGTGGCGCGCAAGCACAGCCTGCCCGAGGTGTGCATCAGCCAGCTCAGCCGCATCT
ATACGCTGCCCAACATTGAGATTCAGGAGGCCTTTTTGAAGCTGCGCGAGCAGGCCAAGTGTCACTACGAGAATG
CCGACGAACTGTCAAGCGGGCTCGACGTCATCAACAACACCAACCTCAACTACTTCAACCCGCAGCAAAAGGCCG
AGTTCTATACGCTCAAGGGCATGTTTCTCGAGAAGCTCAAGCACAAGGACGAGGCCGACAACGCCTACGGAACGG
CCCTGTACTTTGATATAGGAGCGGCAAAGGCCTGGGCTGAATGGGGTCACTTCAACGACCGCAAGTTCAAGGAGG
AACCGTCGGATCTCAACGCGGCGCGTCAGGCTCTGACGTCGTATCTCCAGGCGGCCGGCAGCTACAAGAACGCCA
AGTCGCGCAAGCTGCTGGCCCGGATCCTGTGGCTGCTGAGCCTCGACGACGCCAAGGGAACCATCGCCATGGGCT
TCGACGACTTCAAGGGCGAGACGCCCGTTTGGTACTGGATCACGCTCATCCCCCAGCTGCTGACGGGGCTGGGCC
ACAAGGAGGCGCCTCGCGTCTATCAGATCTTGCTGAGCATCGCCAAGTCGTACCCGCAGGCGCTGTACTTTCAAC
TGCGAACCAACCGCGAGGACATGCACGTCATACGCAAGAGTCAGGAGACCAAGGAGCGGGCGAGGCAGCAGCGGG
CTTCCAGCAGCAACATGTCGCCGACGAAGGCCGAAGCCGACGCCGAGGTCAAGGCTGAGAACGCGGCCGATGGTG
CAGAAGGGGGCGGTTCGACGACGACGACGACGGATCAACACCAGCAGCAGCAGCAGCAGCAACTTCAACAGAAGA
AGCCACCGTGGGAACTCACAGAGGAGATCATGTCGGTCCTCAAGACGGCCTTCCCCCTGCTGGCCCTCTCCATGG
AGGCCATGGTGGACCAGATCCAGAAGCACTTCAAGTGTCCGCCCGACGAGGACGCCTACAGGCTCATCGTGGCCC
TCCTCAACGACGCCCTCACCTACGTCAGCCGCACGCCGGCCTCGTTTGCCCGCAGCGTCAAGTTGCCTGCCGCCA
CCGAGACCAACATCACGCGCTTCGCCGAGACGATCCTACCGACTCACATCAAGAAGTCGTTTGAGAAGGACTTTG
TCGAGGTCAAGCCCACCATGTACGAGTACATCCACAAGCTGCGACGATGGCGTACCAAGTTCGAGGAGAAGCTGG
ACAGACGCGTCGCCCACGCGCCCCTCGAGGCCTTTTCTTCCCACCTCAGCGAGTTCCGCTACCAGAAGTTCGACG
AGGTCGAGATCCCGGGCCAGTATCTCCAGCACAAGGACAAGAACCAGGACTTTGTCCAGATCGAACGCTTCCTCC
CCAACGTCGACCTCGTGCGGTCCTACAGCGCCTCGTACCGTCGTCTCAAGATGCGCGGTCACGACGGCAGCGTCC
ATGCCTGGGCTGTCCAGCATCCAGCCGCCAGACACTGCCGCCGCGAGGAACGCATCCTCCAGCTCTTCCGCCAGC
TCAACCAGACGCTCGGCCGCAAGAAGGAGAGCCGTCGTCGGAGCCTCGAGTTCACGCTGCCCGTCATGGTGCCCC
TGGCGCCGCACATCCGCATCGTGGCCGAGGACACGTCGTACGTCACCCTCCAGGCCGTCTTCGAAGACCACTGCC
GTCGCCACGGCCAGGCAAAGGACGATCCCGTCCTCTACACGCTCGAGAAGCTCCGCGGCGTCCTCGACTCGGACA
GCCCGCAGGCCAAGCTCGAGCTCACGCCCTCGGCCCGTCTCGAGGTCCTGCAGGCCGTCCAGGACAAGTGGGTGC
CCCAGACGACGGCCCTCGACTACTTCCAGCTCGTCTTCCCCCAGTTCGCAGAGTTCTGGCTCTTCCGTCGCCAGT
TCTCCTACCAGCTCTCGGCCCTCTCCTTCATGACGTACATCCTCTACATGCACAACCGCTACCCGTCAAAGATGA
GCATCGCCCGCGCCTCGGGCAACATCTGGGGCTCGGAGCTCATGTCCTTCATGAACCCGCACAAGCCCTTCTTCA
CCAACCCGGAGCCCGTCCCCTTCCGCCTGACCCCCAACCTCCAAGTGCTGATGGGGCCCCTCGCCACCGAGGGCA
TCTTCGCCTGTGCGGTAATGGCCATCGCCCGCTCCCTCACCGAACCGGAAGACGAGCTCGAGCACGCCCTCACCC
TCTTCGTCCGCGACGAGATGATCTTTTGGCTCACCAGCAGCCATCGCTCCGCCATCAGCGAGTCTCAGCTGAGGG
ATTCGGTGCAGCTGAATAGCGATTCCATCGTCAAGCGCGCGGCGAGTCTGGCCAGGAACCCTTCGGGCAATTTAC
CCGCCAACCAGACCGTCATCGACGCCGTGGCCAAGGCTGTGAATCCGATGAATCTGGCGCAGTGCGATGCTCTGT
GGATGCCGTATCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail