Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3276
Gene name
LocationContig_291:3928..4491
Strand-
Gene length (bp)563
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like 3.8E-22 8 129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FIX2|AIG2L_ARATH AIG2-like protein OS=Arabidopsis thaliana GN=At5g39720 PE=1 SV=1 5 135 5.0E-12
sp|P54121|AIG2_ARATH Protein AIG2 OS=Arabidopsis thaliana GN=AIG2 PE=2 SV=1 2 139 3.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3276
MSGEHSAFFYGTLMAPEIFFSVCYGTRRPPQVICQLHTFRPAILNGHCRHRVRLADYPAVVRQEGQSVRGIYATG
LTDANMDKLDRFEGDEYQRVEVDVEVREGTAGEAKKAFVYLFLKRDELELGEWDFEAFRREKMEVWTRQRWDEVE
G*
Coding >Ophun1|3276
ATGAGCGGAGAACACTCAGCCTTCTTCTATGGAACCCTGATGGCTCCGGAAATCTTCTTTAGCGTTTGCTACGGG
ACGAGGCGGCCGCCGCAAGTCATCTGCCAGCTGCACACCTTTAGGCCGGCGATACTGAATGGCCATTGTCGTCAC
CGCGTCAGGCTGGCCGACTACCCCGCCGTCGTGCGGCAGGAGGGTCAGAGCGTCCGGGGCATCTATGCGACGGGT
CTGACGGATGCCAATATGGACAAGCTGGATCGGTTCGAGGGCGATGAGTACCAACGCGTCGAGGTTGATGTTGAG
GTTCGGGAGGGGACGGCTGGCGAGGCGAAGAAGGCGTTTGTATACCTATTCCTGAAGCGGGATGAGCTCGAACTG
GGCGAGTGGGATTTCGAGGCCTTTCGTAGAGAGAAGATGGAGGTGTGGACGCGACAGCGGTGGGACGAGGTTGAA
GGTTAG
Transcript >Ophun1|3276
ATGAGCGGAGAACACTCAGCCTTCTTCTATGGAACCCTGATGGCTCCGGAAATCTTCTTTAGCGTTTGCTACGGG
ACGAGGCGGCCGCCGCAAGTCATCTGCCAGCTGCACACCTTTAGGCCGGCGATACTGAATGGCCATTGTCGTCAC
CGCGTCAGGCTGGCCGACTACCCCGCCGTCGTGCGGCAGGAGGGTCAGAGCGTCCGGGGCATCTATGCGACGGGT
CTGACGGATGCCAATATGGACAAGCTGGATCGGTTCGAGGGCGATGAGTACCAACGCGTCGAGGTTGATGTTGAG
GTTCGGGAGGGGACGGCTGGCGAGGCGAAGAAGGCGTTTGTATACCTATTCCTGAAGCGGGATGAGCTCGAACTG
GGCGAGTGGGATTTCGAGGCCTTTCGTAGAGAGAAGATGGAGGTGTGGACGCGACAGCGGTGGGACGAGGTTGAA
GGTTAG
Gene >Ophun1|3276
ATGAGCGGAGAACACTCAGCCTTCTTCTATGGTCCGTGAGGCATCATGGCAGCTAGCAAATTGACGTCGCTGACT
CGCGCAGGAACCCTGGTAAGCGGACACACGAGCTACCCAGAGCTTTCTCGGCCCTCTTGACTTTTCGGCAGATGG
CTCCGGAAATCTTCTTTAGCGTTTGCTACGGGACGAGGCGGCCGCCGCAAGTCATCTGCCAGCTGCACACCTTTA
GGCCGGCGATACTGAATGGCCATTGTCGTCACCGCGTCAGGCTGGCCGACTACCCCGCCGTCGTGCGGCAGGAGG
GTCAGAGCGTCCGGGGCATCTATGCGACGGGTCTGACGGATGCCAATATGGACAAGCTGGATCGGTTCGAGGGCG
ATGAGTACCAACGCGTCGAGGTTGATGTTGAGGTTCGGGAGGGGACGGCTGGCGAGGCGAAGAAGGCGTTTGTAT
ACCTATTCCTGAAGCGGGATGAGCTCGAACTGGGCGAGTGGGATTTCGAGGCCTTTCGTAGAGAGAAGATGGAGG
TGTGGACGCGACAGCGGTGGGACGAGGTTGAAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail