Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3275
Gene name
LocationContig_291:448..1152
Strand-
Gene length (bp)704
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999526

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA11 2.7E-78 18 210

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|1375
Ophiocordyceps camponoti-floridani Ophcf2|05846
Ophiocordyceps camponoti-rufipedis Ophun1|3275 (this protein)
Ophiocordyceps kimflemingae Ophio5|5058
Ophiocordyceps subramaniannii Hirsu2|8041

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3275
MLVQALTLAGLAATGTAHILISNPVPYGKDSLNNSPLKADGSDFPCKQRNGVYDTAGVSNVYKQGSTQQLEFRGS
AVHGGGSCQVSLTTDAKPTKNSVWKVIKSIEGGCPAKNQGGNMGGGAGADTPFKYDFTIPSELASGNYTLAWTWF
NKIGNREMYMNCAPVSVTGSGGSGGFLNSLPDMFVANLGQGCGTKEGTDVQFPNPGKDLRRR*
Coding >Ophun1|3275
ATGCTCGTCCAAGCCCTCACCCTCGCCGGCCTCGCCGCCACAGGCACCGCCCACATCCTCATCAGCAACCCGGTC
CCTTACGGCAAAGACAGCCTCAACAACAGCCCCCTCAAGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCAAC
GGCGTCTACGACACCGCCGGCGTCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGAGGCGGCTCGTGCCAAGTCTCGCTGACGACGGATGCCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGTCCTGCCAAGAACCAAGGCGGTAACATGGGCGGAGGCGCAGGCGCCGAC
ACTCCCTTCAAGTACGACTTCACCATCCCCAGCGAGCTGGCCTCGGGAAACTACACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGCGAGATGTACATGAACTGCGCTCCCGTCTCCGTCACGGGCTCCGGCGGTTCGGGCGGC
TTCCTCAACTCTCTGCCCGACATGTTCGTCGCCAACCTCGGCCAGGGCTGTGGAACCAAAGAGGGCACCGATGTC
CAGTTCCCCAACCCGGGCAAGGACCTCCGGCGGCGGTAA
Transcript >Ophun1|3275
ATGCTCGTCCAAGCCCTCACCCTCGCCGGCCTCGCCGCCACAGGCACCGCCCACATCCTCATCAGCAACCCGGTC
CCTTACGGCAAAGACAGCCTCAACAACAGCCCCCTCAAGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCAAC
GGCGTCTACGACACCGCCGGCGTCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGAGGCGGCTCGTGCCAAGTCTCGCTGACGACGGATGCCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGTCCTGCCAAGAACCAAGGCGGTAACATGGGCGGAGGCGCAGGCGCCGAC
ACTCCCTTCAAGTACGACTTCACCATCCCCAGCGAGCTGGCCTCGGGAAACTACACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGCGAGATGTACATGAACTGCGCTCCCGTCTCCGTCACGGGCTCCGGCGGTTCGGGCGGC
TTCCTCAACTCTCTGCCCGACATGTTCGTCGCCAACCTCGGCCAGGGCTGTGGAACCAAAGAGGGCACCGATGTC
CAGTTCCCCAACCCGGGCAAGGACCTCCGGCGGCGGTAA
Gene >Ophun1|3275
ATGCTCGTCCAAGCCCTCACCCTCGCCGGCCTCGCCGCCACAGGCACCGCCCACATCCTCATCAGCAACCCGGTC
CCTTACGGCAAAGACAGCCTCAACAACAGCCCCCTCAAGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCAAC
GGCGTCTACGACACCGCCGGCGTCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGAGGCGGCTCGTGCCAAGTCTCGCTGACGACGGATGCCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGTCCTGCCAAGAACCAAGGCGGTAACATGGGCGGAGGCGCAGGCGCCGAC
ACTCCCTTCAAGTACGACTTCACCATCCCCAGCGAGCTGGCCTCGGGAAACTACACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGCGAGATGTACATGAACTGCGCTCCCGTCTCCGTCACGGGCTCCGGCGGTTCGGGCGGC
TTCCTCAACTCTCTGCCCGACATGTTCGTCGCCAACCTCGGCCAGGGCTGTGGAACCAAAGAGGGCACCGATGTC
CAGTTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCGGCCTTTGCTCCTCCCTCCGGCTCG
TGCCCGACTGGCAGCTCCGGCGGCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail