Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3269
Gene name
LocationContig_290:6741..7285
Strand+
Gene length (bp)544
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5737
Ophiocordyceps australis map64 (Brazil) OphauB2|2241
Ophiocordyceps camponoti-floridani Ophcf2|05098
Ophiocordyceps camponoti-rufipedis Ophun1|3269 (this protein)
Ophiocordyceps kimflemingae Ophio5|3223
Ophiocordyceps subramaniannii Hirsu2|3586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3269
MASASPEQAFVSAWSSRYRGATVQDLEPPAALSLNPSDAISVALISAFERDYTHLTIVDSKRRSLLGYISIPHLQ
SLLEAGRVRPEDPLSAAMTRFQRRGKAYRVITMDTTLEDLEGFFRQGVSGGAWRQDFAVITDDKRRFVLGVATVQ
DLEEFVKRRPA*
Coding >Ophun1|3269
ATGGCCTCAGCCTCGCCCGAACAGGCGTTTGTCTCGGCTTGGTCATCGCGCTATCGCGGGGCCACCGTGCAAGAC
CTCGAGCCGCCTGCAGCCCTGTCCCTGAATCCCTCCGATGCCATCTCCGTAGCGCTCATCTCCGCTTTTGAGCGC
GACTACACCCATCTCACCATCGTCGACTCCAAGAGGCGCTCCCTCCTCGGCTACATCTCCATCCCCCATCTACAA
TCCCTCCTCGAAGCCGGCCGCGTCCGGCCAGAGGATCCCCTCAGCGCCGCCATGACGCGCTTCCAGCGCAGGGGA
AAGGCCTACCGCGTCATCACCATGGACACGACGCTCGAGGATCTAGAGGGCTTCTTTCGTCAGGGCGTCTCGGGC
GGGGCCTGGCGTCAGGACTTTGCCGTCATTACGGATGACAAGCGGCGCTTTGTCCTCGGCGTTGCTACCGTTCAG
GACTTGGAAGAGTTTGTGAAGAGGAGGCCTGCGTGA
Transcript >Ophun1|3269
ATGGCCTCAGCCTCGCCCGAACAGGCGTTTGTCTCGGCTTGGTCATCGCGCTATCGCGGGGCCACCGTGCAAGAC
CTCGAGCCGCCTGCAGCCCTGTCCCTGAATCCCTCCGATGCCATCTCCGTAGCGCTCATCTCCGCTTTTGAGCGC
GACTACACCCATCTCACCATCGTCGACTCCAAGAGGCGCTCCCTCCTCGGCTACATCTCCATCCCCCATCTACAA
TCCCTCCTCGAAGCCGGCCGCGTCCGGCCAGAGGATCCCCTCAGCGCCGCCATGACGCGCTTCCAGCGCAGGGGA
AAGGCCTACCGCGTCATCACCATGGACACGACGCTCGAGGATCTAGAGGGCTTCTTTCGTCAGGGCGTCTCGGGC
GGGGCCTGGCGTCAGGACTTTGCCGTCATTACGGATGACAAGCGGCGCTTTGTCCTCGGCGTTGCTACCGTTCAG
GACTTGGAAGAGTTTGTGAAGAGGAGGCCTGCGTGA
Gene >Ophun1|3269
ATGGCCTCAGCCTCGCCCGAACAGGCGTTTGTCTCGGCTTGGTCATCGCGCTATCGCGGGGTATCGTGGCATTTC
TTCCCTCGCCATCGGGGCCTCGACTGACCAGACTTCCATCCAGGCCACCGTGCAAGACCTCGAGCCGCCTGCAGC
CCTGTCCCTGAATCCCTCCGATGCCATCTCCGTAGCGCTCATCTCCGCTTTTGAGCGCGACTACACCCATCTCAC
CATCGTCGACTCCAAGAGGCGCTCCCTCCTCGGCTACATCTCCATCCCCCATCTACAATCCCTCCTCGAAGCCGG
CCGCGTCCGGCCAGAGGATCCCCTCAGCGCCGCCATGACGCGCTTCCAGCGCAGGGGAAAGGCCTACCGCGTCAT
CACCATGGACACGACGCTCGAGGATCTAGAGGGCTTCTTTCGTCAGGGCGTCTCGGGCGGGGCCTGGCGTCAGGA
CTTTGCCGTCATTACGGATGACAAGCGGCGCTTTGTCCTCGGCGTTGCTACCGTTCAGGACTTGGAAGAGTTTGT
GAAGAGGAGGCCTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail