Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3261
Gene name
LocationContig_29:44903..46273
Strand+
Gene length (bp)1370
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 3.0E-95 19 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 16 335 1.0E-64
sp|P40004|YEA4_YEAST UDP-N-acetylglucosamine transporter YEA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA4 PE=1 SV=1 19 333 1.0E-61
sp|Q00974|YEA4_KLULA UDP-N-acetylglucosamine transporter YEA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YEA4 PE=3 SV=1 20 324 3.0E-59
sp|Q9W429|S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster GN=Efr PE=2 SV=1 22 358 6.0E-54
sp|Q7ZW46|S35B4_DANRE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Danio rerio GN=slc35b4 PE=2 SV=1 21 322 6.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 16 335 1.0E-64
sp|P40004|YEA4_YEAST UDP-N-acetylglucosamine transporter YEA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA4 PE=1 SV=1 19 333 1.0E-61
sp|Q00974|YEA4_KLULA UDP-N-acetylglucosamine transporter YEA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YEA4 PE=3 SV=1 20 324 3.0E-59
sp|Q9W429|S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster GN=Efr PE=2 SV=1 22 358 6.0E-54
sp|Q7ZW46|S35B4_DANRE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Danio rerio GN=slc35b4 PE=2 SV=1 21 322 6.0E-53
sp|Q8CIA5|S35B4_MOUSE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35b4 PE=2 SV=2 20 346 7.0E-53
sp|Q95KB4|S35B4_MACFA UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis GN=SLC35B4 PE=2 SV=1 16 346 3.0E-52
sp|Q5R8M3|S35B4_PONAB UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii GN=SLC35B4 PE=2 SV=1 16 346 3.0E-52
sp|Q969S0|S35B4_HUMAN UDP-xylose and UDP-N-acetylglucosamine transporter OS=Homo sapiens GN=SLC35B4 PE=1 SV=1 16 346 6.0E-52
sp|Q869W7|S35B4_DICDI UDP-N-acetylglucosamine transporter slc35b4 OS=Dictyostelium discoideum GN=slc35b4 PE=3 SV=2 13 346 1.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 62 17
3 83 101 18
4 111 128 17
5 135 152 17
6 172 194 22
7 206 228 22
8 238 260 22
9 267 286 19
10 306 324 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3261
MEWLGTPLVQSLLLEAATFGLIFGGCCSNVYALEAIINFESSSGTLLTFTQFLFVAVTSYISQFDRTRPPFYLAP
TKVPLRRWLVNILLFFGINVLNNHAFSYSISIPLHIILRSGGSITTMLAGYLFGKRYSRLQALAVILLSFGIALA
AWSNDEAKVDERKPDRPESAIGFLVLFVAQLFSAALGLHTESLYQQFGPQWRENLFYCHLLSLPLFLPFMPSMAR
VLGQMAASERIEVSTPFLAAGVPVQLAYLATNVITQYACIRGVNLLAANSSALTVTIVLSVRKLVSLIVSIWLFG
NSLPKGTLIGAIIVFSSGALYSMGRAPKTSKDKHSGGMARKEEKQNGSQKMASISKKVN*
Coding >Ophun1|3261
ATGGAGTGGCTCGGCACTCCCCTCGTTCAATCTTTGCTGCTTGAAGCAGCTACCTTCGGCCTAATTTTTGGGGGT
TGCTGTTCAAATGTCTACGCGCTGGAAGCAATCATCAACTTCGAGTCGTCGAGCGGAACGCTCCTGACGTTCACG
CAGTTCCTCTTCGTGGCTGTGACGAGTTACATTTCCCAGTTTGACAGGACCAGGCCGCCCTTTTATCTCGCCCCA
ACAAAAGTGCCTCTGCGTCGTTGGCTCGTCAACATTTTGCTCTTCTTCGGCATCAATGTGTTGAACAACCACGCC
TTCAGTTACAGCATATCCATCCCGCTACATATCATCCTACGGTCCGGTGGCAGCATTACTACGATGCTTGCAGGC
TACCTATTTGGAAAGCGATACTCTCGCCTTCAGGCTTTGGCCGTAATTCTCTTGAGTTTTGGAATCGCGTTGGCC
GCTTGGTCCAACGATGAGGCAAAGGTTGATGAGAGAAAACCCGACCGACCGGAGTCCGCTATCGGCTTTCTCGTA
CTATTTGTGGCTCAGCTGTTCTCGGCCGCCTTAGGTCTCCATACAGAGAGCCTCTATCAGCAATTCGGCCCGCAA
TGGCGAGAGAATCTGTTCTACTGTCATCTTCTGTCACTGCCACTTTTTCTCCCTTTCATGCCTTCCATGGCTCGG
GTCTTGGGTCAAATGGCTGCAAGTGAAAGGATCGAAGTCTCCACGCCATTTCTTGCTGCGGGAGTGCCTGTTCAG
CTAGCATACCTGGCCACAAACGTGATAACCCAATACGCCTGTATCCGTGGCGTCAATCTTCTCGCTGCCAACTCC
TCAGCGCTCACAGTCACAATCGTCTTAAGTGTCCGTAAGCTCGTCAGCTTGATTGTGAGCATTTGGCTCTTTGGC
AACTCGTTACCTAAGGGTACCTTGATCGGCGCTATTATCGTCTTCAGCTCCGGAGCGCTGTACTCAATGGGCCGT
GCACCCAAAACATCCAAAGACAAACACTCAGGCGGCATGGCTAGAAAAGAAGAAAAGCAAAACGGAAGTCAAAAG
ATGGCCTCGATTAGCAAGAAAGTAAACTAG
Transcript >Ophun1|3261
ATGGAGTGGCTCGGCACTCCCCTCGTTCAATCTTTGCTGCTTGAAGCAGCTACCTTCGGCCTAATTTTTGGGGGT
TGCTGTTCAAATGTCTACGCGCTGGAAGCAATCATCAACTTCGAGTCGTCGAGCGGAACGCTCCTGACGTTCACG
CAGTTCCTCTTCGTGGCTGTGACGAGTTACATTTCCCAGTTTGACAGGACCAGGCCGCCCTTTTATCTCGCCCCA
ACAAAAGTGCCTCTGCGTCGTTGGCTCGTCAACATTTTGCTCTTCTTCGGCATCAATGTGTTGAACAACCACGCC
TTCAGTTACAGCATATCCATCCCGCTACATATCATCCTACGGTCCGGTGGCAGCATTACTACGATGCTTGCAGGC
TACCTATTTGGAAAGCGATACTCTCGCCTTCAGGCTTTGGCCGTAATTCTCTTGAGTTTTGGAATCGCGTTGGCC
GCTTGGTCCAACGATGAGGCAAAGGTTGATGAGAGAAAACCCGACCGACCGGAGTCCGCTATCGGCTTTCTCGTA
CTATTTGTGGCTCAGCTGTTCTCGGCCGCCTTAGGTCTCCATACAGAGAGCCTCTATCAGCAATTCGGCCCGCAA
TGGCGAGAGAATCTGTTCTACTGTCATCTTCTGTCACTGCCACTTTTTCTCCCTTTCATGCCTTCCATGGCTCGG
GTCTTGGGTCAAATGGCTGCAAGTGAAAGGATCGAAGTCTCCACGCCATTTCTTGCTGCGGGAGTGCCTGTTCAG
CTAGCATACCTGGCCACAAACGTGATAACCCAATACGCCTGTATCCGTGGCGTCAATCTTCTCGCTGCCAACTCC
TCAGCGCTCACAGTCACAATCGTCTTAAGTGTCCGTAAGCTCGTCAGCTTGATTGTGAGCATTTGGCTCTTTGGC
AACTCGTTACCTAAGGGTACCTTGATCGGCGCTATTATCGTCTTCAGCTCCGGAGCGCTGTACTCAATGGGCCGT
GCACCCAAAACATCCAAAGACAAACACTCAGGCGGCATGGCTAGAAAAGAAGAAAAGCAAAACGGAAGTCAAAAG
ATGGCCTCGATTAGCAAGAAAGTAAACTAG
Gene >Ophun1|3261
ATGGAGTGGCTCGGCACTCCCCTCGTTCAATCTTTGCTGCTTGAAGCAGCTACCTTCGGCCTAATTTTTGGGGGT
TGCTGTTCAAATGTAAGAACCCAAAATGGGCCATATGGCCTTGAAATCACAACTGGGGTACCGCTAACGCTGCAT
CTTAGGTCTACGCGCTGGAAGCAATCATCAAGTTAGTAGAGATGCCGTTGCTTCGTTCGATTGCAGTCGTGAATG
GTTCCTGACGTGTCTGACTCCTCTGAAACTATAGCTTCGAGTCGTCGAGCGGTAAAATCCTCTATCTTCCGGATC
TGATCGCCAGCCGGCTAACTCGCGAATAGGAACGCTCCTGACGTTCACGCAGTTCCTCTTCGTGGCTGTGACGAG
TTACATTTCCCAGTTTGACAGGACCAGGCCGCCCTTTTATCTCGCCCCAACAAAAGTGCCTCTGCGTCGTTGGCT
CGTCAACATTTTGCTCTTCTTCGGCATCAATGTGTTGAACAACCACGCCTTCAGTTACAGCATATCCATCCCGCT
ACATATCATCCTACGGTCCGGTGGCAGCATTACTACGATGCTTGCAGGCTACCTATTTGGAAAGCGATACTCTCG
CCTTCAGGCTTTGGCCGTAATTCTCTTGAGTTTTGGAATCGCGTTGGCCGCTTGGTCCAACGATGAGGCAAAGGT
TAGCCCTAGTTTGGTTTCGAGCTTCATAGCAAAGTCAACGTTTCCGAATACATTGCGAAAGCTCATACTCACTGG
TGCATCTTGTACAGGTTGATGAGAGAAAACCCGACCGACCGGAGTCCGCTATCGGCTTTCTCGTACTATTTGTGG
CTCAGCTGTTCTCGGCCGCCTTAGGTCTCCATACAGAGAGCCTCTATCAGCAATTCGGCCCGCAATGGCGAGAGA
ATCTGTTCTACTGTCATCTTCTGTCACTGCCACTTTTTCTCCCTTTCATGCCTTCCATGGCTCGGGTCTTGGGTC
AAATGGCTGCAAGTGAAAGGATCGAAGTCTCCACGCCATTTCTTGCTGCGGGAGTGCCTGTTCAGCTAGCATACC
TGGCCACAAACGTGATAACCCAATACGCCTGTATCCGTGGCGTCAATCTTCTCGCTGCCAACTCCTCAGCGCTCA
CAGTCACAATCGTCTTAAGTGTCCGTAAGCTCGTCAGCTTGATTGTGAGCATTTGGCTCTTTGGCAACTCGTTAC
CTAAGGGTACCTTGATCGGCGCTATTATCGTCTTCAGCTCCGGAGCGCTGTACTCAATGGGCCGTGCACCCAAAA
CATCCAAAGACAAACACTCAGGCGGCATGGCTAGAAAAGAAGAAAAGCAAAACGGAAGTCAAAAGATGGCCTCGA
TTAGCAAGAAAGTAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail