Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3253
Gene name
LocationContig_29:24358..25355
Strand-
Gene length (bp)997
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03587 EMG1 EMG1/NEP1 methyltransferase 8.8E-78 53 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06287|NEP1_YEAST Ribosomal RNA small subunit methyltransferase NEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMG1 PE=1 SV=1 14 268 1.0E-119
sp|Q9P8P7|NEP1_CANAX Ribosomal RNA small subunit methyltransferase NEP1 OS=Candida albicans GN=NEP1 PE=3 SV=1 25 267 2.0E-115
sp|Q10107|NEP1_SCHPO Ribosomal RNA small subunit methyltransferase mra1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mra1 PE=1 SV=2 41 268 7.0E-104
sp|Q96UP2|NEP1_CANGA Ribosomal RNA small subunit methyltransferase NEP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NEP1 PE=3 SV=1 46 268 3.0E-97
sp|Q92979|NEP1_HUMAN Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens GN=EMG1 PE=1 SV=4 1 268 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06287|NEP1_YEAST Ribosomal RNA small subunit methyltransferase NEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMG1 PE=1 SV=1 14 268 1.0E-119
sp|Q9P8P7|NEP1_CANAX Ribosomal RNA small subunit methyltransferase NEP1 OS=Candida albicans GN=NEP1 PE=3 SV=1 25 267 2.0E-115
sp|Q10107|NEP1_SCHPO Ribosomal RNA small subunit methyltransferase mra1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mra1 PE=1 SV=2 41 268 7.0E-104
sp|Q96UP2|NEP1_CANGA Ribosomal RNA small subunit methyltransferase NEP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NEP1 PE=3 SV=1 46 268 3.0E-97
sp|Q92979|NEP1_HUMAN Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens GN=EMG1 PE=1 SV=4 1 268 3.0E-66
sp|Q9W4J5|NEP1_DROME Ribosomal RNA small subunit methyltransferase NEP1 OS=Drosophila melanogaster GN=CG3527 PE=3 SV=2 49 268 2.0E-65
sp|O35130|NEP1_MOUSE Ribosomal RNA small subunit methyltransferase NEP1 OS=Mus musculus GN=Emg1 PE=1 SV=1 1 268 2.0E-63
sp|Q9XX15|NEP1_CAEEL Ribosomal RNA small subunit methyltransferase nep-1 OS=Caenorhabditis elegans GN=Y39A1A.14 PE=3 SV=1 46 268 2.0E-59
sp|A3DNG9|NEP1_STAMF Ribosomal RNA small subunit methyltransferase Nep1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=nep1 PE=3 SV=1 70 268 5.0E-19
sp|A0B5L3|NEP1_METTP Ribosomal RNA small subunit methyltransferase Nep1 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=nep1 PE=3 SV=1 82 263 2.0E-16
sp|Q57977|NEP1_METJA Ribosomal RNA small subunit methyltransferase Nep1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=nep1 PE=1 SV=1 71 260 3.0E-16
sp|Q5JI44|NEP1_THEKO Ribosomal RNA small subunit methyltransferase Nep1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=nep1 PE=3 SV=1 82 256 4.0E-16
sp|O50087|NEP1_PYRHO Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nep1 PE=3 SV=1 46 268 2.0E-15
sp|B6YTM6|NEP1_THEON Ribosomal RNA small subunit methyltransferase Nep1 OS=Thermococcus onnurineus (strain NA1) GN=nep1 PE=3 SV=1 83 161 4.0E-15
sp|Q9V0M0|NEP1_PYRAB Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nep1 PE=3 SV=1 47 268 6.0E-15
sp|Q97WJ0|NEP1_SULSO Ribosomal RNA small subunit methyltransferase Nep1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=nep1 PE=3 SV=2 53 257 2.0E-13
sp|Q8U1E6|NEP1_PYRFU Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=nep1 PE=3 SV=2 83 163 2.0E-13
sp|C6A116|NEP1_THESM Ribosomal RNA small subunit methyltransferase Nep1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=nep1 PE=3 SV=1 83 161 4.0E-13
sp|Q96YP4|NEP1_SULTO Ribosomal RNA small subunit methyltransferase Nep1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=nep1 PE=3 SV=1 50 254 5.0E-13
sp|Q9YES9|NEP1_AERPE Ribosomal RNA small subunit methyltransferase Nep1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=nep1 PE=3 SV=1 83 196 9.0E-12
sp|O29524|NEP1_ARCFU Ribosomal RNA small subunit methyltransferase Nep1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nep1 PE=1 SV=1 83 256 2.0E-11
sp|A3MWJ1|NEP1_PYRCJ Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=nep1 PE=3 SV=1 51 161 1.0E-09
sp|Q9HJ48|NEP1_THEAC Ribosomal RNA small subunit methyltransferase Nep1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=nep1 PE=3 SV=2 103 262 2.0E-09
sp|B1YD95|NEP1_PYRNV Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=nep1 PE=3 SV=1 70 160 3.0E-09
sp|Q8ZW45|NEP1_PYRAE Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=nep1 PE=3 SV=1 70 161 6.0E-08
sp|Q979E4|NEP1_THEVO Ribosomal RNA small subunit methyltransferase Nep1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=nep1 PE=3 SV=1 103 243 1.0E-07
sp|A1RVH0|NEP1_PYRIL Ribosomal RNA small subunit methyltransferase Nep1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=nep1 PE=3 SV=1 70 262 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0070037 rRNA (pseudouridine) methyltransferase activity Yes
GO:0070475 rRNA base methylation Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0001510 RNA methylation No
GO:0016072 rRNA metabolic process No
GO:0006364 rRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0044260 cellular macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0032259 methylation No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008173 RNA methyltransferase activity No
GO:0000154 rRNA modification No
GO:0006807 nitrogen compound metabolic process No
GO:0008649 rRNA methyltransferase activity No
GO:0016070 RNA metabolic process No
GO:0009451 RNA modification No
GO:0031167 rRNA methylation No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043414 macromolecule methylation No
GO:0140098 catalytic activity, acting on RNA No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0034660 ncRNA metabolic process No
GO:0043412 macromolecule modification No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0034470 ncRNA processing No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6422
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|921
Ophiocordyceps australis map64 (Brazil) OphauB2|6074
Ophiocordyceps camponoti-floridani Ophcf2|01787
Ophiocordyceps camponoti-rufipedis Ophun1|3253 (this protein)
Ophiocordyceps kimflemingae Ophio5|4988

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3253
MAAEAGDMPCTDRRGGLKRPRTQSLPPPSLPLLVAEQHTPIAPADKDTRRLIVVLSNASLETYKASHGGGNRPGA
ARDEKYSLLNSDDHIGVMRRMNRDISDARPDITHQCLLTLLDSPANKAGKLQIYIHTAKGVLIEVSPTVRIPRTF
KRFAGLMVQLLHRLSIRSTNSNEKLLRVVQNPITDHLPHRCRKVTLSFDAPVVRVRDYIEMLDPKESICVFIGAM
AKGADTFADSVVDEKISISNYSLSASVACSKFCHAAEDVWDII*
Coding >Ophun1|3253
ATGGCCGCCGAAGCCGGAGATATGCCGTGCACCGACCGCCGCGGCGGGTTGAAACGGCCTCGCACGCAATCGCTT
CCTCCGCCGTCGTTGCCGCTGCTCGTTGCCGAACAGCATACCCCGATCGCGCCAGCGGATAAGGACACTCGCAGG
TTGATAGTCGTGCTATCCAACGCCAGTCTCGAGACATACAAGGCGTCTCACGGGGGAGGAAACCGGCCAGGAGCT
GCTCGAGACGAAAAGTATTCTCTTCTCAACAGCGATGATCACATTGGGGTGATGCGCCGAATGAATCGGGACATC
AGCGATGCTCGACCCGACATCACACATCAGTGTCTACTCACGCTATTGGATTCTCCCGCCAACAAGGCCGGCAAG
CTGCAAATATACATCCATACGGCAAAGGGCGTCCTGATCGAGGTCTCGCCGACGGTCCGCATCCCCCGCACCTTC
AAGCGGTTTGCCGGTCTCATGGTGCAGCTATTGCACCGTCTTTCGATCCGGTCGACAAACTCCAACGAGAAGCTG
TTGCGGGTGGTACAGAATCCCATAACGGATCATCTGCCTCATCGATGTCGCAAAGTGACGCTCAGCTTCGATGCG
CCCGTGGTCCGTGTTCGCGACTATATCGAGATGCTTGATCCAAAGGAGAGCATCTGCGTCTTTATCGGTGCAATG
GCCAAGGGTGCCGACACGTTCGCCGACTCGGTGGTTGACGAAAAGATATCCATAAGCAACTACTCCCTCTCCGCC
AGTGTGGCATGCAGCAAGTTCTGTCACGCTGCCGAGGACGTGTGGGATATCATCTAG
Transcript >Ophun1|3253
ATGGCCGCCGAAGCCGGAGATATGCCGTGCACCGACCGCCGCGGCGGGTTGAAACGGCCTCGCACGCAATCGCTT
CCTCCGCCGTCGTTGCCGCTGCTCGTTGCCGAACAGCATACCCCGATCGCGCCAGCGGATAAGGACACTCGCAGG
TTGATAGTCGTGCTATCCAACGCCAGTCTCGAGACATACAAGGCGTCTCACGGGGGAGGAAACCGGCCAGGAGCT
GCTCGAGACGAAAAGTATTCTCTTCTCAACAGCGATGATCACATTGGGGTGATGCGCCGAATGAATCGGGACATC
AGCGATGCTCGACCCGACATCACACATCAGTGTCTACTCACGCTATTGGATTCTCCCGCCAACAAGGCCGGCAAG
CTGCAAATATACATCCATACGGCAAAGGGCGTCCTGATCGAGGTCTCGCCGACGGTCCGCATCCCCCGCACCTTC
AAGCGGTTTGCCGGTCTCATGGTGCAGCTATTGCACCGTCTTTCGATCCGGTCGACAAACTCCAACGAGAAGCTG
TTGCGGGTGGTACAGAATCCCATAACGGATCATCTGCCTCATCGATGTCGCAAAGTGACGCTCAGCTTCGATGCG
CCCGTGGTCCGTGTTCGCGACTATATCGAGATGCTTGATCCAAAGGAGAGCATCTGCGTCTTTATCGGTGCAATG
GCCAAGGGTGCCGACACGTTCGCCGACTCGGTGGTTGACGAAAAGATATCCATAAGCAACTACTCCCTCTCCGCC
AGTGTGGCATGCAGCAAGTTCTGTCACGCTGCCGAGGACGTGTGGGATATCATCTAG
Gene >Ophun1|3253
ATGGCCGCCGAAGCCGGAGATATGCCGTGCACCGACCGCCGCGGCGGGTTGAAACGGCCTCGTAGGTTTTTTTTC
TTCTCTTTTTTGCCTTTTTTGAAAAAAATATTCGTTTACCCGGTCGGCGTTTGTTCCAGACACGCAGGCTGCGCA
AACGTGCAAATGGGCGGCTCTTGATTATGTCTAACCGACTGGATGACTTAGGCACGCAATCGCTTCCTCCGCCGT
CGTTGCCGCTGCTCGTTGCCGAACAGCATACCCCGATCGCGCCAGCGGATAAGGACACTCGCAGGTTGATAGTCG
TGCTATCCAACGCCAGTCTCGAGACATACAAGGCGTCTCACGGGGGAGGAAACCGGCCAGGAGCTGCTCGAGACG
AAAAGTATTCTCTTCTCAACAGCGATGATCACATTGGGGTGATGCGCCGAATGAATCGGGACATCAGCGATGCTC
GACCCGACATCACACATCAGGTTCGACGGTCAAAATAACTAATCTGGTTGGTCAATCTGACATTATACAGTGTCT
ACTCACGCTATTGGATTCTCCCGCCAACAAGGCCGGCAAGCTGCAAATATACATCCATACGGCAAAGGGCGTCCT
GATCGAGGTCTCGCCGACGGTCCGCATCCCCCGCACCTTCAAGCGGTTTGCCGGTCTCATGGTGCAGCTATTGCA
CCGTCTTTCGATCCGGTCGACAAACTCCAACGAGAAGCTGTTGCGGGTGGTACAGAATCCCATAACGGATCATCT
GCCTCATCGATGTCGCAAAGTGACGCTCAGCTTCGATGCGCCCGTGGTCCGTGTTCGCGACTATATCGAGATGCT
TGATCCAAAGGAGAGCATCTGCGTCTTTATCGGTGCAATGGCCAAGGGTGCCGACACGTTCGCCGACTCGGTGGT
TGACGAAAAGATATCCATAAGCAACTACTCCCTCTCCGCCAGTGTGGCATGCAGCAAGTTCTGTCACGCTGCCGA
GGACGTGTGGGATATCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail